BLASTX nr result
ID: Forsythia23_contig00011129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00011129 (421 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010039276.1| PREDICTED: structural maintenance of chromos... 105 2e-20 ref|XP_008805238.1| PREDICTED: structural maintenance of chromos... 101 2e-19 gb|KMT09901.1| hypothetical protein BVRB_5g121200 [Beta vulgaris... 100 4e-19 ref|XP_010679304.1| PREDICTED: structural maintenance of chromos... 100 4e-19 ref|XP_010935908.1| PREDICTED: structural maintenance of chromos... 100 5e-19 ref|XP_009766461.1| PREDICTED: structural maintenance of chromos... 99 1e-18 ref|XP_009631519.1| PREDICTED: structural maintenance of chromos... 99 1e-18 gb|KHG16515.1| Structural maintenance of chromosomes 1A [Gossypi... 98 2e-18 ref|XP_009401619.1| PREDICTED: structural maintenance of chromos... 98 2e-18 ref|XP_009401618.1| PREDICTED: structural maintenance of chromos... 98 2e-18 ref|XP_012442774.1| PREDICTED: structural maintenance of chromos... 98 2e-18 gb|KJB11325.1| hypothetical protein B456_001G253800 [Gossypium r... 98 2e-18 ref|XP_007144895.1| hypothetical protein PHAVU_007G1926000g, par... 98 2e-18 ref|XP_010262325.1| PREDICTED: structural maintenance of chromos... 97 3e-18 ref|XP_012828954.1| PREDICTED: structural maintenance of chromos... 97 3e-18 gb|AIU48150.1| structural maintenance of chromosomes protein 1, ... 97 4e-18 gb|AIU48144.1| structural maintenance of chromosomes protein 1, ... 97 4e-18 gb|AIU48107.1| structural maintenance of chromosomes protein 1, ... 97 4e-18 gb|AIU48102.1| structural maintenance of chromosomes protein 1, ... 97 4e-18 gb|EMT13616.1| Structural maintenance of chromosomes protein 1 [... 97 4e-18 >ref|XP_010039276.1| PREDICTED: structural maintenance of chromosomes protein 1 [Eucalyptus grandis] gi|629120245|gb|KCW84735.1| hypothetical protein EUGRSUZ_B01550 [Eucalyptus grandis] Length = 1218 Score = 105 bits (261), Expect = 2e-20 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RLN DA+ GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1164 RLNQDADAGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1218 >ref|XP_008805238.1| PREDICTED: structural maintenance of chromosomes protein 1 [Phoenix dactylifera] Length = 1218 Score = 101 bits (252), Expect = 2e-19 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R N DA+ GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1164 RGNQDADGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1218 >gb|KMT09901.1| hypothetical protein BVRB_5g121200 [Beta vulgaris subsp. vulgaris] Length = 1212 Score = 100 bits (249), Expect = 4e-19 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RL+ DA+ GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCS TLTFDLTKYRES Sbjct: 1158 RLDQDADGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSSTLTFDLTKYRES 1212 >ref|XP_010679304.1| PREDICTED: structural maintenance of chromosomes protein 1 [Beta vulgaris subsp. vulgaris] Length = 1215 Score = 100 bits (249), Expect = 4e-19 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RL+ DA+ GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCS TLTFDLTKYRES Sbjct: 1161 RLDQDADGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSSTLTFDLTKYRES 1215 >ref|XP_010935908.1| PREDICTED: structural maintenance of chromosomes protein 1 [Elaeis guineensis] Length = 1218 Score = 100 bits (248), Expect = 5e-19 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R N +A+ GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1164 RGNQEADGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1218 >ref|XP_009766461.1| PREDICTED: structural maintenance of chromosomes protein 1 [Nicotiana sylvestris] Length = 1218 Score = 98.6 bits (244), Expect = 1e-18 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RLN D E GCGFQSIVISLKD+FYDKAEALVGVYRDS+ CSRTLTFDLTKYRES Sbjct: 1164 RLNQDPEEGCGFQSIVISLKDSFYDKAEALVGVYRDSDLGCSRTLTFDLTKYRES 1218 >ref|XP_009631519.1| PREDICTED: structural maintenance of chromosomes protein 1 [Nicotiana tomentosiformis] Length = 1218 Score = 98.6 bits (244), Expect = 1e-18 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RLN D E GCGFQSIVISLKD+FYDKAEALVGVYRDS+ CSRTLTFDLTKYRES Sbjct: 1164 RLNQDPEEGCGFQSIVISLKDSFYDKAEALVGVYRDSDLGCSRTLTFDLTKYRES 1218 >gb|KHG16515.1| Structural maintenance of chromosomes 1A [Gossypium arboreum] Length = 1207 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R + D+E G GFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1153 RTSQDSEIGSGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1207 >ref|XP_009401619.1| PREDICTED: structural maintenance of chromosomes protein 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 564 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D + GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 514 DGDGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 564 >ref|XP_009401618.1| PREDICTED: structural maintenance of chromosomes protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 1218 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D + GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1168 DGDGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1218 >ref|XP_012442774.1| PREDICTED: structural maintenance of chromosomes protein 1 [Gossypium raimondii] Length = 1217 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R D+E G GFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1163 RTTQDSEIGSGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1217 >gb|KJB11325.1| hypothetical protein B456_001G253800 [Gossypium raimondii] Length = 1240 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/55 (87%), Positives = 50/55 (90%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R D+E G GFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1186 RTTQDSEIGSGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1240 >ref|XP_007144895.1| hypothetical protein PHAVU_007G1926000g, partial [Phaseolus vulgaris] gi|593688523|ref|XP_007144896.1| hypothetical protein PHAVU_007G1926000g, partial [Phaseolus vulgaris] gi|561018085|gb|ESW16889.1| hypothetical protein PHAVU_007G1926000g, partial [Phaseolus vulgaris] gi|561018086|gb|ESW16890.1| hypothetical protein PHAVU_007G1926000g, partial [Phaseolus vulgaris] Length = 394 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R +LDA+ G GFQSIVISLKD FYDKAEALVGVYRDS+RSCSRTLTFDLTKYRES Sbjct: 340 RTSLDADGGSGFQSIVISLKDTFYDKAEALVGVYRDSDRSCSRTLTFDLTKYRES 394 >ref|XP_010262325.1| PREDICTED: structural maintenance of chromosomes protein 1 [Nelumbo nucifera] Length = 1218 Score = 97.4 bits (241), Expect = 3e-18 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 R N D++ G GFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1164 RSNQDSDGGSGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1218 >ref|XP_012828954.1| PREDICTED: structural maintenance of chromosomes protein 1 [Erythranthe guttatus] gi|604297802|gb|EYU17921.1| hypothetical protein MIMGU_mgv1a000351mg [Erythranthe guttata] Length = 1226 Score = 97.4 bits (241), Expect = 3e-18 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = +3 Query: 3 RLNLDAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 RL D E G GFQSIVISLKDNFYDKAEALVGVYRDS++ CSRTLTFDLTKYRES Sbjct: 1172 RLERDVEMGSGFQSIVISLKDNFYDKAEALVGVYRDSDKGCSRTLTFDLTKYRES 1226 >gb|AIU48150.1| structural maintenance of chromosomes protein 1, partial [Trachycarpus fortunei] Length = 997 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 947 DGARGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 997 >gb|AIU48144.1| structural maintenance of chromosomes protein 1, partial [Cinnamomum camphora] Length = 1063 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1013 DGARGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1063 >gb|AIU48107.1| structural maintenance of chromosomes protein 1, partial [Sarcandra glabra] Length = 1060 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1010 DGARGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1060 >gb|AIU48102.1| structural maintenance of chromosomes protein 1, partial [Musa acuminata] Length = 1165 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKYRES Sbjct: 1115 DGARGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 1165 >gb|EMT13616.1| Structural maintenance of chromosomes protein 1 [Aegilops tauschii] Length = 375 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +3 Query: 15 DAEFGCGFQSIVISLKDNFYDKAEALVGVYRDSERSCSRTLTFDLTKYRES 167 D E GCGFQSIVISLKD+FYDKAEALVGVYRDSERSCSRTLTFDLTKY+E+ Sbjct: 325 DGEGGCGFQSIVISLKDSFYDKAEALVGVYRDSERSCSRTLTFDLTKYKEA 375