BLASTX nr result
ID: Forsythia23_contig00010618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00010618 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858345.1| PREDICTED: putative lysine-specific demethyl... 57 4e-06 >ref|XP_012858345.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Erythranthe guttatus] gi|848924457|ref|XP_012858346.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Erythranthe guttatus] gi|848924460|ref|XP_012858347.1| PREDICTED: putative lysine-specific demethylase JMJ16 [Erythranthe guttatus] gi|604300048|gb|EYU19891.1| hypothetical protein MIMGU_mgv1a026881mg [Erythranthe guttata] Length = 1188 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = -3 Query: 338 RILHGLLKKANLEELHALYSILHNKSEKSTNYRSSVTHLLDEEIHRRPR 192 +IL+GL KAN EEL LYS+LHNKS ST+ +S +T LL +EIH+ PR Sbjct: 1142 KILNGLFNKANTEELRMLYSVLHNKS--STDEQSLLTKLLSDEIHKHPR 1188