BLASTX nr result
ID: Forsythia23_contig00010528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00010528 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847953.1| PREDICTED: cysteine proteinase inhibitor B-l... 69 1e-09 ref|XP_012853126.1| PREDICTED: cysteine proteinase inhibitor B-l... 68 3e-09 ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [... 61 3e-07 ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus nota... 57 4e-06 gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canep... 57 4e-06 ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citr... 57 6e-06 >ref|XP_012847953.1| PREDICTED: cysteine proteinase inhibitor B-like [Erythranthe guttatus] gi|604316037|gb|EYU28504.1| hypothetical protein MIMGU_mgv1a016168mg [Erythranthe guttata] Length = 132 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSKELLKFAPSTP 180 YYLKISAAT G G K F+AV+VVKPW+HSKEL+ FAPSTP Sbjct: 86 YYLKISAATRGGGAAKSFEAVIVVKPWIHSKELVNFAPSTP 126 >ref|XP_012853126.1| PREDICTED: cysteine proteinase inhibitor B-like [Erythranthe guttatus] gi|604305097|gb|EYU24293.1| hypothetical protein MIMGU_mgv1a016063mg [Erythranthe guttata] Length = 135 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSKELLKFAPSTP 180 YYLKISAAT G G K F+AV+VVKPW+HSKEL+ FAPSTP Sbjct: 90 YYLKISAATRGGGPAKNFEAVIVVKPWIHSKELVNFAPSTP 130 >ref|XP_011084146.1| PREDICTED: cysteine proteinase inhibitor B [Sesamum indicum] Length = 131 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSKELLKFAPSTP 180 YYLKISA T + FDAVVVVKPW+HSKELL FAPS P Sbjct: 86 YYLKISAVTRDGAPARTFDAVVVVKPWLHSKELLNFAPSPP 126 >ref|XP_010101112.1| Cysteine proteinase inhibitor 10 [Morus notabilis] gi|587898658|gb|EXB87085.1| Cysteine proteinase inhibitor 10 [Morus notabilis] gi|746657152|gb|AJD79057.1| CPI-6 [Morus alba var. atropurpurea] Length = 143 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSKELLKFAPST 183 YYLK+SA + G +IFD+VVVVKPW+ S++LL FAPST Sbjct: 98 YYLKVSATATETGESRIFDSVVVVKPWLRSRQLLNFAPST 137 >gb|AEQ54766.1| cysteine proteinase inhibitor CPI-1 [Coffea canephora] Length = 139 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSK--ELLKFAPSTPT 177 YYLKI A TS GVPK++DA+VVV+PWVH+K +LL F+PS T Sbjct: 96 YYLKIKATTSS-GVPKVYDAIVVVRPWVHTKPRQLLNFSPSPAT 138 >ref|XP_006421050.1| hypothetical protein CICLE_v10006584mg [Citrus clementina] gi|557522923|gb|ESR34290.1| hypothetical protein CICLE_v10006584mg [Citrus clementina] Length = 130 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 302 YYLKISAATSGVGVPKIFDAVVVVKPWVHSKELLKFAPS 186 YYL I A T G ++FD++VV+KPW+HSKELLKFAPS Sbjct: 91 YYLTIEATTGENGEIQMFDSIVVIKPWLHSKELLKFAPS 129