BLASTX nr result
ID: Forsythia23_contig00008820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00008820 (367 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835078.1| PREDICTED: thioredoxin-like protein HCF164, ... 93 8e-17 ref|XP_011085523.1| PREDICTED: thioredoxin-like protein HCF164, ... 87 4e-15 ref|XP_011085522.1| PREDICTED: thioredoxin-like protein HCF164, ... 87 4e-15 >ref|XP_012835078.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic [Erythranthe guttatus] gi|604335478|gb|EYU39387.1| hypothetical protein MIMGU_mgv1a011778mg [Erythranthe guttata] Length = 271 Score = 92.8 bits (229), Expect = 8e-17 Identities = 48/95 (50%), Positives = 62/95 (65%), Gaps = 1/95 (1%) Frame = -1 Query: 286 MARVATTSSAVGLPRHRTYYLHSRHQSPLFVNFSLQSRNKTRRHHRIFCQSDPNSFDS-G 110 MAR A+TSS +GLPR L S HQ P FVNFS + KTRRH RIFCQ++P+ DS Sbjct: 1 MARAASTSSTIGLPRFSPSSLQSPHQPPSFVNFSSCVQKKTRRHRRIFCQNNPDPVDSAA 60 Query: 109 TAEEKVLVDSESENDGNTANSSKETAASSVGAGFP 5 A+EK L++ ES +G++ N++ A S G GFP Sbjct: 61 AADEKPLIEPESGTNGSSDNAAAAEATPSTGTGFP 95 >ref|XP_011085523.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic isoform X2 [Sesamum indicum] Length = 268 Score = 87.0 bits (214), Expect = 4e-15 Identities = 47/94 (50%), Positives = 59/94 (62%) Frame = -1 Query: 286 MARVATTSSAVGLPRHRTYYLHSRHQSPLFVNFSLQSRNKTRRHHRIFCQSDPNSFDSGT 107 MAR+ +TS+AVGL R L Q P VNFS +NK HHRIFCQ++P+S DS Sbjct: 1 MARLVSTSTAVGLSTFRPSSLQYNQQQPRLVNFSY-FQNKHHGHHRIFCQTNPDSVDSAA 59 Query: 106 AEEKVLVDSESENDGNTANSSKETAASSVGAGFP 5 EEK V+ ESE DGN ++++ SS GAGFP Sbjct: 60 TEEKRAVELESEIDGNASSAATIETTSSTGAGFP 93 >ref|XP_011085522.1| PREDICTED: thioredoxin-like protein HCF164, chloroplastic isoform X1 [Sesamum indicum] Length = 284 Score = 87.0 bits (214), Expect = 4e-15 Identities = 47/94 (50%), Positives = 59/94 (62%) Frame = -1 Query: 286 MARVATTSSAVGLPRHRTYYLHSRHQSPLFVNFSLQSRNKTRRHHRIFCQSDPNSFDSGT 107 MAR+ +TS+AVGL R L Q P VNFS +NK HHRIFCQ++P+S DS Sbjct: 1 MARLVSTSTAVGLSTFRPSSLQYNQQQPRLVNFSY-FQNKHHGHHRIFCQTNPDSVDSAA 59 Query: 106 AEEKVLVDSESENDGNTANSSKETAASSVGAGFP 5 EEK V+ ESE DGN ++++ SS GAGFP Sbjct: 60 TEEKRAVELESEIDGNASSAATIETTSSTGAGFP 93