BLASTX nr result
ID: Forsythia23_contig00008764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00008764 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01757.1| unnamed protein product [Coffea canephora] 110 5e-22 ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcr... 108 1e-21 ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcr... 107 3e-21 emb|CBI37506.3| unnamed protein product [Vitis vinifera] 107 3e-21 ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcr... 103 4e-20 ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcr... 103 4e-20 gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [... 103 6e-20 gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [... 100 5e-19 ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcr... 100 5e-19 ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcr... 100 5e-19 ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcr... 100 5e-19 ref|XP_010272854.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_010272853.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_009777635.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_009777634.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_009773556.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_006364840.1| PREDICTED: RNA polymerase I-specific transcr... 99 1e-18 ref|XP_012837320.1| PREDICTED: RNA polymerase I-specific transcr... 98 2e-18 ref|XP_010540653.1| PREDICTED: RNA polymerase I-specific transcr... 98 2e-18 ref|XP_009618724.1| PREDICTED: RNA polymerase I-specific transcr... 98 2e-18 >emb|CDP01757.1| unnamed protein product [Coffea canephora] Length = 637 Score = 110 bits (274), Expect = 5e-22 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR+AK S +F+VP FV G+LESELS FGG+ERLDMFFPFDP LL+KSDRFIRPNFV Sbjct: 474 FLRVAKSSHLFNVPQNFVSDGLLESELSMTFGGLERLDMFFPFDPCLLKKSDRFIRPNFV 533 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 534 YWSMVRS 540 >ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Sesamum indicum] Length = 626 Score = 108 bits (271), Expect = 1e-21 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRL K + +FS+P +FV+YGMLESE SRAFGG+ER DMFFPFDP LLRK D +IRPN+V Sbjct: 472 FLRLVKANHVFSLPQSFVEYGMLESENSRAFGGMERFDMFFPFDPCLLRKCDSYIRPNYV 531 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 532 YWSMVRS 538 >ref|XP_010649342.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3 [Vitis vinifera] Length = 627 Score = 107 bits (267), Expect = 3e-21 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR AK +R+F+V +TF+ +LESELSRAFGGIERLDMFFPFDP LL+K DRFIRPNFV Sbjct: 476 FLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERLDMFFPFDPCLLKKCDRFIRPNFV 535 Query: 136 YWSMVR 119 YWSM+R Sbjct: 536 YWSMIR 541 >emb|CBI37506.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 107 bits (267), Expect = 3e-21 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR AK +R+F+V +TF+ +LESELSRAFGGIERLDMFFPFDP LL+K DRFIRPNFV Sbjct: 476 FLRQAKAARLFTVSETFIFSDLLESELSRAFGGIERLDMFFPFDPCLLKKCDRFIRPNFV 535 Query: 136 YWSMVR 119 YWSM+R Sbjct: 536 YWSMIR 541 >ref|XP_006483467.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X2 [Citrus sinensis] Length = 535 Score = 103 bits (257), Expect = 4e-20 Identities = 56/107 (52%), Positives = 68/107 (63%), Gaps = 2/107 (1%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TFV +LESELSRAFGG+ERLDMFFPFDP LL+KSD FIRPNFV Sbjct: 386 FLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIRPNFV 445 Query: 136 YWSMVRNXXXXXXXXXXXXXXXXXXAGISIADDI--SVDEGDAHLDE 2 YWSMV+ + D + S DE D LDE Sbjct: 446 YWSMVKTAYHGDEEDNSDEDVDEDNGDHVMVDGVGRSPDEQDLDLDE 492 >ref|XP_006483466.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like isoform X1 [Citrus sinensis] Length = 628 Score = 103 bits (257), Expect = 4e-20 Identities = 56/107 (52%), Positives = 68/107 (63%), Gaps = 2/107 (1%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TFV +LESELSRAFGG+ERLDMFFPFDP LL+KSD FIRPNFV Sbjct: 479 FLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIRPNFV 538 Query: 136 YWSMVRNXXXXXXXXXXXXXXXXXXAGISIADDI--SVDEGDAHLDE 2 YWSMV+ + D + S DE D LDE Sbjct: 539 YWSMVKTAYHGDEEDNSDEDVDEDNGDHVMVDGVGRSPDEQDLDLDE 585 >gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis] Length = 292 Score = 103 bits (256), Expect = 6e-20 Identities = 48/66 (72%), Positives = 58/66 (87%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TFV +LESELSRAFGG+ERLDMFFPFDP LL+KSD FIRPNFV Sbjct: 143 FLQQSKAARLFTVSETFVFNDLLESELSRAFGGLERLDMFFPFDPCLLKKSDSFIRPNFV 202 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 203 YWSMVK 208 >gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [Citrus sinensis] Length = 292 Score = 100 bits (248), Expect = 5e-19 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TF+ +LESELSR FGG+ERLDMFFPFDP LL+KSD FIRPNF+ Sbjct: 143 FLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSFIRPNFI 202 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 203 YWSMVK 208 >ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Citrus sinensis] Length = 315 Score = 100 bits (248), Expect = 5e-19 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TF+ +LESELSR FGG+ERLDMFFPFDP LL+KSD FIRPNF+ Sbjct: 166 FLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSFIRPNFI 225 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 226 YWSMVK 231 >ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X2 [Citrus sinensis] Length = 535 Score = 100 bits (248), Expect = 5e-19 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TF+ +LESELSR FGG+ERLDMFFPFDP LL+KSD FIRPNF+ Sbjct: 386 FLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSFIRPNFI 445 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 446 YWSMVK 451 >ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X1 [Citrus sinensis] Length = 628 Score = 100 bits (248), Expect = 5e-19 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FL+ +K +R+F+V +TF+ +LESELSR FGG+ERLDMFFPFDP LL+KSD FIRPNF+ Sbjct: 479 FLQQSKAARLFTVSETFIFNDLLESELSRDFGGLERLDMFFPFDPCLLKKSDSFIRPNFI 538 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 539 YWSMVK 544 >ref|XP_010272854.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Nelumbo nucifera] gi|720053835|ref|XP_010272855.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Nelumbo nucifera] Length = 631 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR AK + +F+V +TF+ +LES+LS+AFGG+ERLDMFFPFDP LL+K DRFIRP+FV Sbjct: 479 FLRQAKAAHLFTVSETFLFNNLLESDLSKAFGGMERLDMFFPFDPCLLKKCDRFIRPSFV 538 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 539 YWSMVK 544 >ref|XP_010272853.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Nelumbo nucifera] Length = 631 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/66 (68%), Positives = 57/66 (86%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR AK + +F+V +TF+ +LES+LS+AFGG+ERLDMFFPFDP LL+K DRFIRP+FV Sbjct: 479 FLRQAKAAHLFTVSETFLFNNLLESDLSKAFGGMERLDMFFPFDPCLLKKCDRFIRPSFV 538 Query: 136 YWSMVR 119 YWSMV+ Sbjct: 539 YWSMVK 544 >ref|XP_009777635.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 isoform X2 [Nicotiana sylvestris] gi|698581766|ref|XP_009777636.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 isoform X2 [Nicotiana sylvestris] Length = 569 Score = 98.6 bits (244), Expect = 1e-18 Identities = 49/67 (73%), Positives = 56/67 (83%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRLAK + + VPD FV G+LES+LS +FGG ERLDMFFPFDP LL +SDRFIRPNFV Sbjct: 424 FLRLAKVTNL-DVPDNFVSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIRPNFV 482 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 483 YWSMVRS 489 >ref|XP_009777634.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 isoform X1 [Nicotiana sylvestris] Length = 619 Score = 98.6 bits (244), Expect = 1e-18 Identities = 49/67 (73%), Positives = 56/67 (83%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRLAK + + VPD FV G+LES+LS +FGG ERLDMFFPFDP LL +SDRFIRPNFV Sbjct: 474 FLRLAKVTNL-DVPDNFVSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIRPNFV 532 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 533 YWSMVRS 539 >ref|XP_009773556.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Nicotiana sylvestris] Length = 801 Score = 98.6 bits (244), Expect = 1e-18 Identities = 49/67 (73%), Positives = 56/67 (83%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRLAK + + VPD FV G+LES+LS +FGG ERLDMFFPFDP LL +SDRFIRPNFV Sbjct: 654 FLRLAKVTNL-DVPDNFVSSGLLESDLSISFGGRERLDMFFPFDPCLLLRSDRFIRPNFV 712 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 713 YWSMVRS 719 >ref|XP_006364840.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Solanum tuberosum] Length = 618 Score = 98.6 bits (244), Expect = 1e-18 Identities = 50/67 (74%), Positives = 54/67 (80%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRLAK + + VPD FV +LESELS AFGG ERLD FFPFDP LL KSDRFIRPNFV Sbjct: 472 FLRLAKVTHL-DVPDNFVSSNLLESELSMAFGGRERLDTFFPFDPCLLMKSDRFIRPNFV 530 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 531 YWSMVRS 537 >ref|XP_012837320.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Erythranthe guttatus] Length = 625 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/66 (68%), Positives = 53/66 (80%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRL K S + S+P +F+D+G+LESE SRAFGG ER DMFFPFDP LLRK D +IR N+V Sbjct: 473 FLRLVKASNVISLPQSFLDHGLLESEHSRAFGGSERFDMFFPFDPCLLRKCDSYIRDNYV 532 Query: 136 YWSMVR 119 YWS VR Sbjct: 533 YWSTVR 538 >ref|XP_010540653.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Tarenaya hassleriana] Length = 614 Score = 98.2 bits (243), Expect = 2e-18 Identities = 47/65 (72%), Positives = 55/65 (84%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLR AK + +F++ +TFV MLESELSRAFGG+ERLDMFFPFDP LL+ S+ FIRPNFV Sbjct: 474 FLRQAKSAGLFTISETFVFDDMLESELSRAFGGLERLDMFFPFDPCLLKISESFIRPNFV 533 Query: 136 YWSMV 122 YWSMV Sbjct: 534 YWSMV 538 >ref|XP_009618724.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Nicotiana tomentosiformis] Length = 690 Score = 98.2 bits (243), Expect = 2e-18 Identities = 49/67 (73%), Positives = 56/67 (83%) Frame = -1 Query: 316 FLRLAKRSRIFSVPDTFVDYGMLESELSRAFGGIERLDMFFPFDPYLLRKSDRFIRPNFV 137 FLRLAK + + VPD FV G+LES+LS +FGG ERLDMFFPFDP LL +SDRFIRPNFV Sbjct: 543 FLRLAKVTNL-DVPDNFVSSGVLESDLSVSFGGRERLDMFFPFDPCLLLRSDRFIRPNFV 601 Query: 136 YWSMVRN 116 YWSMVR+ Sbjct: 602 YWSMVRS 608