BLASTX nr result
ID: Forsythia23_contig00008481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00008481 (396 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257... 58 3e-06 >ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257433 [Vitis vinifera] Length = 2026 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -3 Query: 394 VQMLEEAEPCKLVGIIVSKDGVTKNEEPRDKKF*PRAYR 278 VQM+EEAEPC+LVGIIV+KDGVTK E + +KF P YR Sbjct: 948 VQMIEEAEPCRLVGIIVNKDGVTKKMEGKTEKFNPSPYR 986