BLASTX nr result
ID: Forsythia23_contig00008258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00008258 (455 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837154.1| PREDICTED: eukaryotic translation initiation... 69 9e-10 ref|XP_011092882.1| PREDICTED: eukaryotic translation initiation... 69 2e-09 ref|XP_011088563.1| PREDICTED: eukaryotic translation initiation... 58 3e-06 emb|CDO96942.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_012837154.1| PREDICTED: eukaryotic translation initiation factor 4B [Erythranthe guttatus] gi|604333570|gb|EYU37921.1| hypothetical protein MIMGU_mgv1a007029mg [Erythranthe guttata] Length = 422 Score = 69.3 bits (168), Expect = 9e-10 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = -1 Query: 455 PAAWKRSSWSGNGRERSQ-EFRTERTWRKPESVDSRPQSAEKTENGPAEDGED 300 P KRS WSGNGR+R Q E +TE+ WRKPESV SRPQSA ++ENG AE+ E+ Sbjct: 356 PVPAKRSFWSGNGRDRVQPEHKTEKAWRKPESVGSRPQSAGESENGTAENTEN 408 >ref|XP_011092882.1| PREDICTED: eukaryotic translation initiation factor 4B-like [Sesamum indicum] Length = 399 Score = 68.6 bits (166), Expect = 2e-09 Identities = 38/59 (64%), Positives = 43/59 (72%), Gaps = 3/59 (5%) Frame = -1 Query: 455 PAAWKRSSWSGNGRER-SQEFRTERTWRKPESVDSRPQSAEKTE--NGPAEDGEDKDPQ 288 PA KRS WS NGRER QE +TER+WRK E+VDSRPQSA +TE NG A D E +D Q Sbjct: 340 PAVGKRSFWSENGRERLQQEDKTERSWRKQEAVDSRPQSAGETENGNGNAGDPEARDSQ 398 >ref|XP_011088563.1| PREDICTED: eukaryotic translation initiation factor 4B [Sesamum indicum] Length = 408 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 443 KRSSWSGNGRERSQ-EFRTERTWRKPESVDSRPQSAEKTENGPAEDGED 300 KRS WSGNGR+RS+ E +TER WRK ES D QS+ ++EN PAE E+ Sbjct: 347 KRSFWSGNGRDRSRLEDKTERAWRKQESADLPSQSSGESENEPAESTEN 395 >emb|CDO96942.1| unnamed protein product [Coffea canephora] Length = 388 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/60 (55%), Positives = 37/60 (61%), Gaps = 3/60 (5%) Frame = -1 Query: 455 PAAWKRSSWSGNGRER-SQEFRTERTWRKPESV--DSRPQSAEKTENGPAEDGEDKDPQM 285 PA KR SGN R QE + ER WRKPE D+RP SAEKTE+ P E+ EDK QM Sbjct: 329 PAFGKRGFGSGNWRGGFQQEDKNERAWRKPEPQPEDARPLSAEKTEDVPVEEAEDKSSQM 388