BLASTX nr result
ID: Forsythia23_contig00007456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00007456 (605 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012088999.1| PREDICTED: 26S protease regulatory subunit 6... 69 2e-09 emb|CBI39511.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_010659638.1| PREDICTED: 26S protease regulatory subunit 6... 69 2e-09 ref|XP_010103420.1| 26S protease regulatory subunit 6A-A-like pr... 68 4e-09 gb|AAB70397.1| Similar to probable Mg-dependent ATPase (pir|S566... 68 4e-09 ref|XP_009124018.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_012464314.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_011648845.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 gb|KJB81028.1| hypothetical protein B456_013G125900 [Gossypium r... 68 4e-09 gb|KJB81027.1| hypothetical protein B456_013G125900 [Gossypium r... 68 4e-09 ref|XP_012434686.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_011092251.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_011087611.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_011023689.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 gb|KHN03969.1| 26S protease regulatory subunit 6A like [Glycine ... 68 4e-09 gb|KHN16103.1| 26S protease regulatory subunit 6A like A [Glycin... 68 4e-09 ref|XP_010679177.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_010674056.1| PREDICTED: 26S protease regulatory subunit 6... 68 4e-09 ref|XP_010553724.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease... 68 4e-09 ref|XP_010549702.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease... 68 4e-09 >ref|XP_012088999.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Jatropha curcas] gi|643708556|gb|KDP23472.1| hypothetical protein JCGZ_23305 [Jatropha curcas] Length = 423 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 423 >emb|CBI39511.3| unnamed protein product [Vitis vinifera] Length = 405 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA Sbjct: 373 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 405 >ref|XP_010659638.1| PREDICTED: 26S protease regulatory subunit 6A homolog A [Vitis vinifera] gi|147844475|emb|CAN80003.1| hypothetical protein VITISV_001355 [Vitis vinifera] Length = 423 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 423 >ref|XP_010103420.1| 26S protease regulatory subunit 6A-A-like protein [Morus notabilis] gi|587907788|gb|EXB95775.1| 26S protease regulatory subunit 6A-A-like protein [Morus notabilis] Length = 181 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 149 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 181 >gb|AAB70397.1| Similar to probable Mg-dependent ATPase (pir|S56671). ESTs gb|T46782,gb|AA04798 come from this gene [Arabidopsis thaliana] Length = 419 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 387 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 419 >ref|XP_009124018.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Brassica rapa] gi|3024434|sp|O23894.1|PRS6A_BRACM RecName: Full=26S protease regulatory subunit 6A homolog; AltName: Full=Tat-binding protein homolog 1; Short=TBP-1 gi|2564337|dbj|BAA22951.1| Tat binding protein 1 [Brassica rapa subsp. oleifera] gi|674914322|emb|CDY18782.1| BnaAnng02470D [Brassica napus] gi|674914341|emb|CDY18801.1| BnaAnng02660D [Brassica napus] Length = 424 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 392 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 424 >ref|XP_012464314.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Gossypium raimondii] Length = 423 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >ref|XP_011648845.1| PREDICTED: 26S protease regulatory subunit 6A homolog isoform X2 [Cucumis sativus] Length = 347 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 315 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 347 >gb|KJB81028.1| hypothetical protein B456_013G125900 [Gossypium raimondii] Length = 373 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 341 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 373 >gb|KJB81027.1| hypothetical protein B456_013G125900 [Gossypium raimondii] Length = 501 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 469 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 501 >ref|XP_012434686.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Gossypium raimondii] gi|763778846|gb|KJB45969.1| hypothetical protein B456_007G341200 [Gossypium raimondii] Length = 423 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >ref|XP_011092251.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Sesamum indicum] Length = 422 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 390 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 422 >ref|XP_011087611.1| PREDICTED: 26S protease regulatory subunit 6A homolog A [Sesamum indicum] Length = 422 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 390 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 422 >ref|XP_011023689.1| PREDICTED: 26S protease regulatory subunit 6A homolog A [Populus euphratica] Length = 423 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >gb|KHN03969.1| 26S protease regulatory subunit 6A like [Glycine soja] Length = 425 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 393 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 425 >gb|KHN16103.1| 26S protease regulatory subunit 6A like A [Glycine soja] Length = 423 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >ref|XP_010679177.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Beta vulgaris subsp. vulgaris] gi|870858798|gb|KMT10286.1| hypothetical protein BVRB_5g120410 [Beta vulgaris subsp. vulgaris] Length = 421 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 389 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 421 >ref|XP_010674056.1| PREDICTED: 26S protease regulatory subunit 6A homolog [Beta vulgaris subsp. vulgaris] gi|870863049|gb|KMT14226.1| hypothetical protein BVRB_4g075850 [Beta vulgaris subsp. vulgaris] Length = 421 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 389 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 421 >ref|XP_010553724.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6A homolog [Tarenaya hassleriana] Length = 423 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 391 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 423 >ref|XP_010549702.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6A homolog [Tarenaya hassleriana] Length = 422 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 603 ALRRDATEVNHEDFNEGIIQVQAKKKSSLNYYA 505 ALRRDATEVNHEDFNEGIIQVQAKKK+SLNYYA Sbjct: 390 ALRRDATEVNHEDFNEGIIQVQAKKKASLNYYA 422