BLASTX nr result
ID: Forsythia23_contig00007066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00007066 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008676712.1| PREDICTED: uncharacterized protein LOC100217... 89 1e-15 ref|NP_001137078.1| uncharacterized protein LOC100217251 [Zea ma... 89 1e-15 ref|XP_012838678.1| PREDICTED: 40S ribosomal protein S15a [Eryth... 89 1e-15 ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] g... 88 3e-15 ref|XP_012081569.1| PREDICTED: 40S ribosomal protein S15a-4-like... 88 3e-15 ref|XP_012081549.1| PREDICTED: 40S ribosomal protein S15a-1 [Jat... 88 3e-15 ref|XP_012466363.1| PREDICTED: 40S ribosomal protein S15a-like [... 88 3e-15 gb|KJB83794.1| hypothetical protein B456_013G265000 [Gossypium r... 88 3e-15 gb|KJB73330.1| hypothetical protein B456_011G230200 [Gossypium r... 88 3e-15 gb|KJB20169.1| hypothetical protein B456_003G136100 [Gossypium r... 88 3e-15 gb|KJB20168.1| hypothetical protein B456_003G136100 [Gossypium r... 88 3e-15 ref|XP_012474480.1| PREDICTED: 40S ribosomal protein S15a-1-like... 88 3e-15 ref|XP_011073203.1| PREDICTED: 40S ribosomal protein S15a-like [... 88 3e-15 ref|XP_011094909.1| PREDICTED: 40S ribosomal protein S15a-like [... 88 3e-15 ref|XP_011033902.1| PREDICTED: 40S ribosomal protein S15a-1 isof... 88 3e-15 ref|XP_010937690.1| PREDICTED: 40S ribosomal protein S15a-like [... 88 3e-15 ref|XP_011025081.1| PREDICTED: 40S ribosomal protein S15a-like i... 88 3e-15 ref|XP_011024999.1| PREDICTED: 40S ribosomal protein S15a-like i... 88 3e-15 gb|KHN33076.1| 40S ribosomal protein S15a-1 [Glycine soja] 88 3e-15 ref|XP_010669840.1| PREDICTED: 40S ribosomal protein S15a-1 [Bet... 88 3e-15 >ref|XP_008676712.1| PREDICTED: uncharacterized protein LOC100217251 isoform X1 [Zea mays] gi|195635415|gb|ACG37176.1| 40S ribosomal protein S15a [Zea mays] Length = 130 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 130 >ref|NP_001137078.1| uncharacterized protein LOC100217251 [Zea mays] gi|194698256|gb|ACF83212.1| unknown [Zea mays] gi|413925272|gb|AFW65204.1| putative ribosomal protein S8 family protein [Zea mays] Length = 153 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY Sbjct: 112 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 153 >ref|XP_012838678.1| PREDICTED: 40S ribosomal protein S15a [Erythranthe guttatus] gi|848907365|ref|XP_012852816.1| PREDICTED: 40S ribosomal protein S15a [Erythranthe guttatus] gi|848928370|ref|XP_012827790.1| PREDICTED: 40S ribosomal protein S15a [Erythranthe guttatus] gi|604298967|gb|EYU18937.1| hypothetical protein MIMGU_mgv1a016211mg [Erythranthe guttata] gi|604305419|gb|EYU24563.1| hypothetical protein MIMGU_mgv1a016215mg [Erythranthe guttata] gi|604331399|gb|EYU36257.1| hypothetical protein MIMGU_mgv1a016232mg [Erythranthe guttata] Length = 130 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 130 >ref|NP_001059160.1| Os07g0208000 [Oryza sativa Japonica Group] gi|573950515|ref|XP_006657549.1| PREDICTED: 40S ribosomal protein S15a-1-like [Oryza brachyantha] gi|582044878|pdb|3J60|W Chain W, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|28411802|dbj|BAC57277.1| ribosomal protein S15 [Oryza sativa Japonica Group] gi|113610696|dbj|BAF21074.1| Os07g0208000 [Oryza sativa Japonica Group] gi|125557646|gb|EAZ03182.1| hypothetical protein OsI_25335 [Oryza sativa Indica Group] gi|125599505|gb|EAZ39081.1| hypothetical protein OsJ_23513 [Oryza sativa Japonica Group] gi|215693112|dbj|BAG88494.1| unnamed protein product [Oryza sativa Japonica Group] Length = 130 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_012081569.1| PREDICTED: 40S ribosomal protein S15a-4-like [Jatropha curcas] Length = 139 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 98 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 139 >ref|XP_012081549.1| PREDICTED: 40S ribosomal protein S15a-1 [Jatropha curcas] Length = 185 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 144 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 185 >ref|XP_012466363.1| PREDICTED: 40S ribosomal protein S15a-like [Gossypium raimondii] gi|763817557|gb|KJB84360.1| hypothetical protein B456_N020900 [Gossypium raimondii] Length = 105 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 64 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >gb|KJB83794.1| hypothetical protein B456_013G265000 [Gossypium raimondii] Length = 240 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 199 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 240 >gb|KJB73330.1| hypothetical protein B456_011G230200 [Gossypium raimondii] Length = 93 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 52 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 93 >gb|KJB20169.1| hypothetical protein B456_003G136100 [Gossypium raimondii] Length = 98 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 57 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 98 >gb|KJB20168.1| hypothetical protein B456_003G136100 [Gossypium raimondii] Length = 136 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 95 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 136 >ref|XP_012474480.1| PREDICTED: 40S ribosomal protein S15a-1-like [Gossypium raimondii] gi|763741353|gb|KJB08852.1| hypothetical protein B456_001G108200 [Gossypium raimondii] Length = 174 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 133 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 174 >ref|XP_011073203.1| PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] gi|747084071|ref|XP_011089429.1| PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] gi|747084073|ref|XP_011089430.1| PREDICTED: 40S ribosomal protein S15a [Sesamum indicum] Length = 130 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_011094909.1| PREDICTED: 40S ribosomal protein S15a-like [Sesamum indicum] Length = 252 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 211 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 252 >ref|XP_011033902.1| PREDICTED: 40S ribosomal protein S15a-1 isoform X1 [Populus euphratica] Length = 136 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 95 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 136 >ref|XP_010937690.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842030|ref|XP_010937692.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842034|ref|XP_010937693.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] gi|743842038|ref|XP_010937694.1| PREDICTED: 40S ribosomal protein S15a-like [Elaeis guineensis] Length = 130 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >ref|XP_011025081.1| PREDICTED: 40S ribosomal protein S15a-like isoform X2 [Populus euphratica] Length = 157 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 116 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 157 >ref|XP_011024999.1| PREDICTED: 40S ribosomal protein S15a-like isoform X1 [Populus euphratica] Length = 159 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 118 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 159 >gb|KHN33076.1| 40S ribosomal protein S15a-1 [Glycine soja] Length = 180 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 139 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 180 >ref|XP_010669840.1| PREDICTED: 40S ribosomal protein S15a-1 [Beta vulgaris subsp. vulgaris] gi|870866571|gb|KMT17530.1| hypothetical protein BVRB_2g037330 [Beta vulgaris subsp. vulgaris] Length = 130 Score = 87.8 bits (216), Expect = 3e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 338 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKSVGGKVLGFFY 213 WTARLLPSRQFGYIVLTTSAGIMDHEEARRK+VGGKVLGFFY Sbjct: 89 WTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130