BLASTX nr result
ID: Forsythia23_contig00006127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00006127 (390 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Py... 108 6e-22 ref|XP_008361335.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Ma... 108 6e-22 ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Ci... 107 2e-21 ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cu... 105 3e-21 ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cu... 105 3e-21 ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricin... 107 4e-21 ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pr... 104 7e-21 ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prun... 104 7e-21 ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Se... 106 7e-21 ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 105 9e-21 gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja] 105 1e-20 gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja] 105 1e-20 ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Be... 105 1e-20 ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Mu... 105 1e-20 ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 105 1e-20 ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-lik... 105 1e-20 ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [El... 104 3e-20 emb|CDP21367.1| unnamed protein product [Coffea canephora] 104 3e-20 gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula] 104 3e-20 ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Po... 103 3e-20 >ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri] Length = 432 Score = 108 bits (269), Expect(2) = 6e-22 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNV+ MPGNGDVPFTHAN SLARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 374 KKNVVDMPGNGDVPFTHANISLARRELGYKPTTDLQTGLKKFVRWYLSYYGY 425 Score = 22.3 bits (46), Expect(2) = 6e-22 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 425 YNHGKPVN 432 >ref|XP_008361335.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica] Length = 432 Score = 108 bits (269), Expect(2) = 6e-22 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNV+ MPGNGDVPFTHAN SLARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 374 KKNVVEMPGNGDVPFTHANISLARRELGYKPTTDLQTGLKKFVRWYLSYYGY 425 Score = 22.3 bits (46), Expect(2) = 6e-22 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 425 YNHGKPVN 432 >ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cicer arietinum] Length = 432 Score = 107 bits (268), Expect = 2e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN SLARRELGYKPTTDLQTGLKKFVKWYLSYYGY Sbjct: 376 KRNIVDMPGNGDVPFTHANISLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 427 >ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo] Length = 431 Score = 105 bits (263), Expect(2) = 3e-21 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNV+ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 373 KKNVVEMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVRWYLSYYGY 424 Score = 22.3 bits (46), Expect(2) = 3e-21 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 424 YNHGKPVN 431 >ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis sativus] gi|700205957|gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus] Length = 431 Score = 105 bits (263), Expect(2) = 3e-21 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNV+ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 373 KKNVVEMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVRWYLSYYGY 424 Score = 22.3 bits (46), Expect(2) = 3e-21 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 424 YNHGKPVN 431 >ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] gi|223532383|gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis] Length = 433 Score = 107 bits (266), Expect = 4e-21 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+NV+ MPGNGDVPFTHAN SLARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 375 KRNVVDMPGNGDVPFTHANISLARRELGYKPTTDLQTGLKKFVRWYLSYYGY 426 >ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume] Length = 432 Score = 104 bits (260), Expect(2) = 7e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKN + MPGNGDVPFTHAN SLARRE GYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 374 KKNFVDMPGNGDVPFTHANISLARREFGYKPTTDLQTGLKKFVRWYLSYYGY 425 Score = 22.3 bits (46), Expect(2) = 7e-21 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 425 YNHGKPVN 432 >ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica] gi|462419317|gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica] Length = 432 Score = 104 bits (260), Expect(2) = 7e-21 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKN + MPGNGDVPFTHAN SLARRE GYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 374 KKNFVDMPGNGDVPFTHANISLARREFGYKPTTDLQTGLKKFVRWYLSYYGY 425 Score = 22.3 bits (46), Expect(2) = 7e-21 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 229 YNHGKPLN 206 YNHGKP+N Sbjct: 425 YNHGKPVN 432 >ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum] Length = 432 Score = 106 bits (264), Expect = 7e-21 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNVI MPGNGDVPFTHAN S ARRELGYKPTTDLQTGL+KFVKWYLSYYGY Sbjct: 374 KKNVIEMPGNGDVPFTHANISSARRELGYKPTTDLQTGLRKFVKWYLSYYGY 425 >ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera] Length = 431 Score = 105 bits (263), Expect = 9e-21 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKN+I MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 371 KKNIIDMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVRWYLSYYGY 422 >gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja] Length = 341 Score = 105 bits (262), Expect = 1e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFVKWYLSYYGY Sbjct: 283 KRNIVDMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYGY 334 >gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja] Length = 262 Score = 105 bits (262), Expect = 1e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFVKWYLSYYGY Sbjct: 204 KRNIVDMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYGY 255 >ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. vulgaris] gi|870851474|gb|KMT03521.1| hypothetical protein BVRB_8g191980 [Beta vulgaris subsp. vulgaris] Length = 434 Score = 105 bits (262), Expect = 1e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKNV+ MPGNGDVPFTHAN SLARR+ GYKPTTDLQTGLKKFV+WYLSYYGY Sbjct: 376 KKNVVEMPGNGDVPFTHANISLARRDFGYKPTTDLQTGLKKFVRWYLSYYGY 427 >ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. malaccensis] Length = 444 Score = 105 bits (262), Expect = 1e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGYKP 229 KKNV+ MPGNGDVPFTHAN SLAR ELGYKPTT+L+TGLKKFV+WYLSYYGY P Sbjct: 374 KKNVVEMPGNGDVPFTHANISLARAELGYKPTTNLETGLKKFVRWYLSYYGYSP 427 >ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max] Length = 431 Score = 105 bits (262), Expect = 1e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFVKWYLSYYGY Sbjct: 373 KRNIVDMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYGY 424 >ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max] Length = 431 Score = 105 bits (262), Expect = 1e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN S ARRELGYKPTTDLQTGLKKFVKWYLSYYGY Sbjct: 373 KRNIVDMPGNGDVPFTHANISSARRELGYKPTTDLQTGLKKFVKWYLSYYGY 424 >ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis] Length = 432 Score = 104 bits (259), Expect = 3e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGYKP 229 K+NV+ MPGNGDVPFTHAN SLAR ELGYKPTT+L+TGLKKFVKWYL YYGY+P Sbjct: 373 KRNVVEMPGNGDVPFTHANISLARAELGYKPTTNLETGLKKFVKWYLHYYGYRP 426 >emb|CDP21367.1| unnamed protein product [Coffea canephora] Length = 433 Score = 104 bits (259), Expect = 3e-20 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 KKN + MPGNGDVPFTHAN SLARRELGYKPTTDLQTGLKKFVKWYL+YYG+ Sbjct: 374 KKNYVDMPGNGDVPFTHANISLARRELGYKPTTDLQTGLKKFVKWYLAYYGH 425 >gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula] Length = 434 Score = 104 bits (259), Expect = 3e-20 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGYKPTIM 220 KKN++ MPGNGDVPFTHAN + ARRE GYKPTTD+QTGLKKFVKWYLSYYGY T + Sbjct: 377 KKNIVDMPGNGDVPFTHANITSARREFGYKPTTDIQTGLKKFVKWYLSYYGYGKTTL 433 >ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica] Length = 431 Score = 103 bits (258), Expect = 3e-20 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 390 KKNVISMPGNGDVPFTHANTSLARRELGYKPTTDLQTGLKKFVKWYLSYYGY 235 K+N++ MPGNGDVPFTHAN SLA+RELGYKPTTDL+TGLKKFVKWYL+YYGY Sbjct: 373 KRNIVDMPGNGDVPFTHANISLAQRELGYKPTTDLETGLKKFVKWYLTYYGY 424