BLASTX nr result
ID: Forsythia23_contig00006099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00006099 (327 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006349016.1| PREDICTED: vacuolar protein sorting-associat... 57 6e-06 >ref|XP_006349016.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum tuberosum] gi|723745074|ref|XP_010313300.1| PREDICTED: vacuolar protein sorting-associated protein 24 homolog 1-like [Solanum lycopersicum] Length = 220 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 326 LDSXXXXXXXXXXXDKVLTAIAGETAAQLPEAIRKEKLKQPAQSV 192 LDS DKVLTAIAGET AQLPEA+RKEKLKQPAQ+V Sbjct: 154 LDSEDMEEEIEEEVDKVLTAIAGETTAQLPEAVRKEKLKQPAQAV 198