BLASTX nr result
ID: Forsythia23_contig00005823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00005823 (428 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas p... 82 1e-13 ref|XP_012084959.1| PREDICTED: metallothionein-like protein type... 81 2e-13 gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus g... 79 1e-12 emb|CAB85630.1| putative metallothionein-like protein [Vitis vin... 78 3e-12 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 74 3e-11 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 72 1e-10 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 71 2e-10 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 71 3e-10 ref|WP_048460945.1| hypothetical protein, partial [Streptomyces ... 70 4e-10 gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb... 70 4e-10 sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein... 70 4e-10 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 70 4e-10 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 70 7e-10 ref|XP_007212343.1| hypothetical protein PRUPE_ppa014506mg [Prun... 70 7e-10 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 70 7e-10 ref|XP_009757034.1| PREDICTED: metallothionein-like protein type... 69 9e-10 gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 69 2e-09 ref|XP_003628521.1| Metallothionein-like protein [Medicago trunc... 69 2e-09 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 69 2e-09 >ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas pseudoalcaligenes] gi|782990300|gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 82.0 bits (201), Expect = 1e-13 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 261 MS CG+CDC D+SQCVKKG++YGIDIVET KSY+ETIVMDAPAA Sbjct: 22 MSSTCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAA 66 >ref|XP_012084959.1| PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] gi|282848222|gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] gi|643714554|gb|KDP27057.1| hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS CG+CDC D+SQCVKKG++Y DIVETEKS++ TIVMD PA AEND Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus grandis] Length = 69 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS KCG+CDC DQSQC KKG++Y D VETEKS+IET+ MDAP AAEND Sbjct: 1 MSDKCGNCDCADQSQCTKKGSSYAADFVETEKSHIETVFMDAP-AAEND 48 >emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 261 CG+CDC D+SQCVKKGN+YGIDIVETEKSY+ T+VM+ PAA Sbjct: 4 CGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAA 44 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 261 MS CG+CDC D+SQCVKKG++Y DIVETEKS++ TI+MD PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAA 45 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 74.3 bits (181), Expect = 3e-11 Identities = 31/45 (68%), Positives = 42/45 (93%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 CG+CDC D+SQCVKKGN+YGI+I+ETEKSY++ +V +APAAA+N+ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVV-EAPAAAKNE 47 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 CG+CDC D+SQCVKKGN+YGIDIVETEKSY++ +++ A AAE+D Sbjct: 4 CGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIV-AAEAAEHD 47 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPA 264 MS CG+CDC D+SQCVKKG++Y DIVETEKS++ T+VM+ PA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPA 44 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 261 MS CG+CDC D+SQCVKKG++Y D+VETEKS + TIVM+ PAA Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEVPAA 45 >ref|WP_048460945.1| hypothetical protein, partial [Streptomyces sp. HNS054] Length = 88 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = -1 Query: 425 FSASFGT-NSTMSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 FS +F T ST CG+CDC D+SQCVKKGN YG+DIVETEKSY + AAEND Sbjct: 12 FSLAFATFPSTAMSTCGNCDCADKSQCVKKGNGYGVDIVETEKSYYGD-AGEVVTAAEND 70 >gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb|ABV58318.1| metallothionein type 3 [Oryza coarctata] Length = 64 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS KCG+CDC D+SQCVKKGN+YG+ +V+TEKS++E I A A AEND Sbjct: 1 MSDKCGNCDCADKSQCVKKGNSYGVVLVDTEKSHLEEI---AAAGAEND 46 >sp|P43389.1|MT3_ACTDE RecName: Full=Metallothionein-like protein type 3 [Actinidia deliciosa] gi|1086020|pir||S48037 metallothionein-like protein - kiwi fruit gi|450241|gb|AAA53072.1| metallothionein-like protein [Actinidia deliciosa] Length = 63 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAA 261 MS KCG+CDC D SQCVKKGN+ IDIVET+KSYIE +VM PAA Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIEDVVMGVPAA 43 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 CG+CDC D+SQCVKKGN+YGI+I+ETEKS ++ DAPAAAE++ Sbjct: 4 CGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI-DAPAAAEHE 47 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 [Carica papaya] gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS CG+CDC D++QCVKKG++Y DI+ETEKS I T+VMDAP AAEND Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKS-IMTVVMDAP-AAEND 47 >ref|XP_007212343.1| hypothetical protein PRUPE_ppa014506mg [Prunus persica] gi|462408208|gb|EMJ13542.1| hypothetical protein PRUPE_ppa014506mg [Prunus persica] Length = 66 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS KC DC+CTD SQC KKG++Y + IVETE ++T++MDAP AAEND Sbjct: 1 MSSKCSDCNCTDSSQCTKKGSSYDLVIVETENRSMDTVIMDAP-AAEND 48 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 69.7 bits (169), Expect = 7e-10 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS CG+CDC D++QCVK GN YG+DIVETEK +ET+VM+ P A END Sbjct: 1 MSNTCGNCDCADKTQCVK-GNKYGVDIVETEKRMVETVVMEVP-AGEND 47 >ref|XP_009757034.1| PREDICTED: metallothionein-like protein type 3 [Nicotiana sylvestris] Length = 66 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 MS KCG+CDC+ SQCVKK N Y ++IVETEKSY E+IVM+A AAE+D Sbjct: 1 MSDKCGNCDCSSASQCVKKENQYNLEIVETEKSYSESIVMNA-GAAEHD 48 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 CGDCDC D+SQCVKKGN YG+ I+ETEKSY E +V + AAAE D Sbjct: 4 CGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVV-EVAAAAEPD 47 >ref|XP_003628521.1| Metallothionein-like protein [Medicago truncatula] gi|355522543|gb|AET02997.1| metallothionein-like protein type 3 [Medicago truncatula] gi|388521467|gb|AFK48795.1| unknown [Medicago truncatula] Length = 63 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 395 MSGKCGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPA 264 MS CG+CDC D+SQC KGN YG+ IVET+KS++ET+VMDAPA Sbjct: 1 MSSSCGNCDCADKSQC-GKGNNYGMTIVETQKSFVETVVMDAPA 43 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 383 CGDCDCTDQSQCVKKGNAYGIDIVETEKSYIETIVMDAPAAAEND 249 CGDCDC D+SQCVKKGN YG+ I+ETEKSY E +V + AAAE D Sbjct: 4 CGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVV-EVAAAAEPD 47