BLASTX nr result
ID: Forsythia23_contig00005816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00005816 (464 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus g... 57 5e-06 >gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis] Length = 381 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -3 Query: 462 IWVTILSTYSNEKSEARISEVPAAEANVDASSEFPPEV 349 IWVTILSTYSNEKSEARI+EVP AEAN A S PPEV Sbjct: 336 IWVTILSTYSNEKSEARIAEVP-AEANPGAQSLNPPEV 372