BLASTX nr result
ID: Forsythia23_contig00004773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00004773 (538 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009631641.1| PREDICTED: F-box protein SKIP22-like [Nicoti... 58 3e-06 >ref|XP_009631641.1| PREDICTED: F-box protein SKIP22-like [Nicotiana tomentosiformis] Length = 501 Score = 57.8 bits (138), Expect = 3e-06 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 15/106 (14%) Frame = -3 Query: 536 KYAEQIG---AEGVEARGGWKKAFVRTWKNRKLGASRRLERTRL---------PNPYMVP 393 KY EQ G G G WK FV++W++RK + + R R+ PNP+ P Sbjct: 398 KYVEQFGDANTPGGGEGGHWKDKFVKSWESRK--RRKMISRRRVVDPLRFLGGPNPFPGP 455 Query: 392 WGPRIRGGYRDIGPLFEDHVP---MILGRRTFSPHCNLGGPNRSNF 264 W P I GG D+ P D+ P ++ R P C+LGG +RSNF Sbjct: 456 WRPHIIGGDYDLLPPQFDNTPPSRLLCPLRNHVPRCHLGG-HRSNF 500