BLASTX nr result
ID: Forsythia23_contig00003760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00003760 (434 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW67817.1| hypothetical protein EUGRSUZ_F01546 [Eucalyptus g... 89 2e-15 ref|XP_010060923.1| PREDICTED: J domain-containing protein requi... 89 2e-15 ref|XP_009599410.1| PREDICTED: J domain-containing protein requi... 88 2e-15 ref|XP_008220772.1| PREDICTED: J domain-containing protein requi... 87 3e-15 ref|XP_009783433.1| PREDICTED: J domain-containing protein requi... 87 4e-15 ref|XP_009364681.1| PREDICTED: J domain-containing protein requi... 87 6e-15 ref|XP_011031582.1| PREDICTED: J domain-containing protein requi... 86 7e-15 ref|XP_010664661.1| PREDICTED: J domain-containing protein requi... 86 1e-14 ref|XP_010254923.1| PREDICTED: J domain-containing protein requi... 86 1e-14 ref|XP_010254922.1| PREDICTED: J domain-containing protein requi... 86 1e-14 ref|XP_002281702.1| PREDICTED: J domain-containing protein requi... 86 1e-14 ref|XP_007225147.1| hypothetical protein PRUPE_ppa002474mg [Prun... 86 1e-14 ref|XP_011017302.1| PREDICTED: J domain-containing protein requi... 85 2e-14 ref|XP_011017301.1| PREDICTED: J domain-containing protein requi... 85 2e-14 emb|CDP07551.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_006386529.1| hypothetical protein POPTR_0002s13540g [Popu... 85 2e-14 ref|XP_006386528.1| hypothetical protein POPTR_0002s13540g [Popu... 85 2e-14 ref|XP_006386527.1| hypothetical protein POPTR_0002s13540g [Popu... 85 2e-14 ref|XP_004293220.1| PREDICTED: J domain-containing protein requi... 85 2e-14 ref|XP_009365581.1| PREDICTED: J domain-containing protein requi... 85 2e-14 >gb|KCW67817.1| hypothetical protein EUGRSUZ_F01546 [Eucalyptus grandis] Length = 651 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGAASHQKYIAE+VFDILQEAW HFN++G Sbjct: 606 YQKALLCLHPDKLQQKGAASHQKYIAEQVFDILQEAWTHFNSLG 649 >ref|XP_010060923.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 [Eucalyptus grandis] gi|629102347|gb|KCW67816.1| hypothetical protein EUGRSUZ_F01546 [Eucalyptus grandis] Length = 764 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGAASHQKYIAE+VFDILQEAW HFN++G Sbjct: 719 YQKALLCLHPDKLQQKGAASHQKYIAEQVFDILQEAWTHFNSLG 762 >ref|XP_009599410.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 [Nicotiana tomentosiformis] Length = 730 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALL +HPDKLQQKGAASHQKYIAEKVFDILQEAWDHFN++G Sbjct: 685 YQRALLYIHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNSLG 728 >ref|XP_008220772.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 [Prunus mume] Length = 742 Score = 87.4 bits (215), Expect = 3e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGAASHQKYIA KVFDILQEAW+HFN++G Sbjct: 697 YQRALLCLHPDKLQQKGAASHQKYIAAKVFDILQEAWNHFNSLG 740 >ref|XP_009783433.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 [Nicotiana sylvestris] Length = 730 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALL +HPDKLQQKGAA+HQKYIAEKVFDILQEAWDHFN++G Sbjct: 685 YQRALLYIHPDKLQQKGAAAHQKYIAEKVFDILQEAWDHFNSLG 728 >ref|XP_009364681.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1-like [Pyrus x bretschneideri] Length = 750 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGAASH KY+A KVFDILQEAWDHFN++G Sbjct: 705 YQRALLCLHPDKLQQKGAASHHKYLAAKVFDILQEAWDHFNSLG 748 >ref|XP_011031582.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1-like [Populus euphratica] Length = 725 Score = 86.3 bits (212), Expect = 7e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SHQKY AEK+FDILQEAW HFN++G Sbjct: 680 YQKALLCLHPDKLQQKGATSHQKYTAEKIFDILQEAWTHFNSLG 723 >ref|XP_010664661.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 isoform X2 [Vitis vinifera] Length = 741 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGAA HQKYIAEKVFD LQEAW HFN++G Sbjct: 696 YQKALLCLHPDKLQQKGAAVHQKYIAEKVFDSLQEAWTHFNSLG 739 >ref|XP_010254923.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 isoform X2 [Nelumbo nucifera] Length = 627 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKG A H+KYIAEKVFDILQEAW+HFN++G Sbjct: 582 YQKALLCLHPDKLQQKGVALHKKYIAEKVFDILQEAWNHFNSLG 625 >ref|XP_010254922.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 isoform X1 [Nelumbo nucifera] Length = 780 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKG A H+KYIAEKVFDILQEAW+HFN++G Sbjct: 735 YQKALLCLHPDKLQQKGVALHKKYIAEKVFDILQEAWNHFNSLG 778 >ref|XP_002281702.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 isoform X1 [Vitis vinifera] gi|302142455|emb|CBI19658.3| unnamed protein product [Vitis vinifera] Length = 766 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGAA HQKYIAEKVFD LQEAW HFN++G Sbjct: 721 YQKALLCLHPDKLQQKGAAVHQKYIAEKVFDSLQEAWTHFNSLG 764 >ref|XP_007225147.1| hypothetical protein PRUPE_ppa002474mg [Prunus persica] gi|462422083|gb|EMJ26346.1| hypothetical protein PRUPE_ppa002474mg [Prunus persica] Length = 669 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGAASH KYIA KVFDILQEAW+HFN++G Sbjct: 624 YQRALLCLHPDKLQQKGAASHHKYIAAKVFDILQEAWNHFNSLG 667 >ref|XP_011017302.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1-like isoform X2 [Populus euphratica] Length = 733 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SH+K IAEKVFDILQEAW HFNT+G Sbjct: 688 YQKALLCLHPDKLQQKGATSHEKDIAEKVFDILQEAWTHFNTLG 731 >ref|XP_011017301.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1-like isoform X1 [Populus euphratica] Length = 734 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SH+K IAEKVFDILQEAW HFNT+G Sbjct: 689 YQKALLCLHPDKLQQKGATSHEKDIAEKVFDILQEAWTHFNTLG 732 >emb|CDP07551.1| unnamed protein product [Coffea canephora] Length = 707 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGAASHQ++IAE+VFDILQEAW HFN++G Sbjct: 662 YQRALLCLHPDKLQQKGAASHQRFIAEQVFDILQEAWSHFNSLG 705 >ref|XP_006386529.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] gi|550344943|gb|ERP64326.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] Length = 748 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SH+K IAEKVFDILQEAW HFNT+G Sbjct: 703 YQKALLCLHPDKLQQKGATSHEKDIAEKVFDILQEAWTHFNTLG 746 >ref|XP_006386528.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] gi|550344942|gb|ERP64325.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] Length = 736 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SH+K IAEKVFDILQEAW HFNT+G Sbjct: 691 YQKALLCLHPDKLQQKGATSHEKDIAEKVFDILQEAWTHFNTLG 734 >ref|XP_006386527.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] gi|550344941|gb|ERP64324.1| hypothetical protein POPTR_0002s13540g [Populus trichocarpa] Length = 735 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQKALLC+HPDKLQQKGA SH+K IAEKVFDILQEAW HFNT+G Sbjct: 690 YQKALLCLHPDKLQQKGATSHEKDIAEKVFDILQEAWTHFNTLG 733 >ref|XP_004293220.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1 [Fragaria vesca subsp. vesca] Length = 765 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGA S QKYIAEKVFDILQEAW+HFN++G Sbjct: 720 YQRALLCLHPDKLQQKGATSQQKYIAEKVFDILQEAWNHFNSLG 763 >ref|XP_009365581.1| PREDICTED: J domain-containing protein required for chloroplast accumulation response 1-like [Pyrus x bretschneideri] Length = 747 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -2 Query: 433 YQKALLCVHPDKLQQKGAASHQKYIAEKVFDILQEAWDHFNTIG 302 YQ+ALLC+HPDKLQQKGA SH KY+A KVFD+LQEAWDHFN++G Sbjct: 702 YQRALLCLHPDKLQQKGATSHHKYLAAKVFDVLQEAWDHFNSLG 745