BLASTX nr result
ID: Forsythia23_contig00002031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00002031 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72282.1| methylenetetrahydrofolate reductase [Genlisea aurea] 89 2e-15 ref|XP_004239699.1| PREDICTED: probable methylenetetrahydrofolat... 87 3e-15 ref|XP_006353237.1| PREDICTED: methylenetetrahydrofolate reducta... 87 4e-15 ref|XP_004250093.1| PREDICTED: methylenetetrahydrofolate reducta... 87 4e-15 ref|XP_009600429.1| PREDICTED: probable methylenetetrahydrofolat... 86 7e-15 ref|NP_001289452.1| probable methylenetetrahydrofolate reductase... 86 1e-14 gb|AEL33271.1| methylenetetrahydrofolate reductase [Nicotiana to... 86 1e-14 gb|AEL33268.1| methylenetetrahydrofolate reductase [Nicotiana ta... 86 1e-14 ref|XP_011074033.1| PREDICTED: probable methylenetetrahydrofolat... 85 2e-14 ref|XP_012081877.1| PREDICTED: methylenetetrahydrofolate reducta... 85 2e-14 ref|XP_009785052.1| PREDICTED: probable methylenetetrahydrofolat... 85 2e-14 ref|XP_012081878.1| PREDICTED: probable methylenetetrahydrofolat... 85 2e-14 ref|XP_006345827.1| PREDICTED: probable methylenetetrahydrofolat... 85 2e-14 ref|NP_001289509.1| methylenetetrahydrofolate reductase 2-like [... 84 3e-14 gb|AEL33267.1| methylenetetrahydrofolate reductase [Nicotiana ta... 84 3e-14 ref|XP_002529223.1| methylenetetrahydrofolate reductase, putativ... 84 5e-14 ref|XP_011074036.1| PREDICTED: probable methylenetetrahydrofolat... 83 8e-14 ref|XP_011005230.1| PREDICTED: methylenetetrahydrofolate reducta... 82 2e-13 ref|XP_011004536.1| PREDICTED: methylenetetrahydrofolate reducta... 81 2e-13 ref|XP_010251464.1| PREDICTED: methylenetetrahydrofolate reducta... 81 2e-13 >gb|EPS72282.1| methylenetetrahydrofolate reductase [Genlisea aurea] Length = 552 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 S+GWA LYPD+DPSRK+LEEV++NY+LVS VDNDYINGDLFAVFKD+ Sbjct: 506 SKGWAKLYPDNDPSRKILEEVRKNYYLVSLVDNDYINGDLFAVFKDL 552 >ref|XP_004239699.1| PREDICTED: probable methylenetetrahydrofolate reductase [Solanum lycopersicum] Length = 596 Score = 87.4 bits (215), Expect = 3e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDIGN 180 SRGWA LYP++DPSR LLE+VQ +YFLVS VDNDYINGDLFA+FKDI N Sbjct: 548 SRGWAQLYPENDPSRTLLEQVQNSYFLVSLVDNDYINGDLFAIFKDIWN 596 >ref|XP_006353237.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Solanum tuberosum] Length = 594 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +YFLVS VDNDYINGDLF++FKDI Sbjct: 548 SRGWAQLYPETDPSRKLLEQVQNSYFLVSLVDNDYINGDLFSIFKDI 594 >ref|XP_004250093.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Solanum lycopersicum] Length = 594 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +YFLVS VDNDYINGDLF++FKDI Sbjct: 548 SRGWAQLYPETDPSRKLLEQVQNSYFLVSLVDNDYINGDLFSIFKDI 594 >ref|XP_009600429.1| PREDICTED: probable methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 594 Score = 86.3 bits (212), Expect = 7e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LY +SDPSRKLLE+VQ +YFLVS VDNDYINGDLFA+FKDI Sbjct: 548 SRGWAQLYQESDPSRKLLEQVQNSYFLVSLVDNDYINGDLFAIFKDI 594 >ref|NP_001289452.1| probable methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] gi|342722663|gb|AEL33272.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +Y+LVS VDNDYINGDLF++FKDI Sbjct: 549 SRGWAQLYPETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >gb|AEL33271.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +Y+LVS VDNDYINGDLF++FKDI Sbjct: 549 SRGWAQLYPETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >gb|AEL33268.1| methylenetetrahydrofolate reductase [Nicotiana tabacum] gi|342722659|gb|AEL33270.1| methylenetetrahydrofolate reductase [Nicotiana tomentosiformis] Length = 595 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +Y+LVS VDNDYINGDLF++FKDI Sbjct: 549 SRGWAQLYPETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFKDI 595 >ref|XP_011074033.1| PREDICTED: probable methylenetetrahydrofolate reductase [Sesamum indicum] gi|747055583|ref|XP_011074034.1| PREDICTED: probable methylenetetrahydrofolate reductase [Sesamum indicum] Length = 595 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP+ DPSRKLLEEVQ Y+LVS VDNDY++GDLFAVFKDI Sbjct: 549 SRGWAKLYPEDDPSRKLLEEVQSKYYLVSLVDNDYVHGDLFAVFKDI 595 >ref|XP_012081877.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Jatropha curcas] Length = 100 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA+LYP+ DPSRKLLEEVQ NYFLVS VDNDYI+GD+FA+F D+ Sbjct: 54 SRGWASLYPEGDPSRKLLEEVQDNYFLVSLVDNDYIHGDIFAIFADL 100 >ref|XP_009785052.1| PREDICTED: probable methylenetetrahydrofolate reductase [Nicotiana sylvestris] Length = 594 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA L+ +SDPSRKLLE+VQ +YFLVS VDNDYINGDLFA+FKDI Sbjct: 548 SRGWAQLFQESDPSRKLLEQVQNSYFLVSLVDNDYINGDLFAIFKDI 594 >ref|XP_012081878.1| PREDICTED: probable methylenetetrahydrofolate reductase [Jatropha curcas] gi|643718240|gb|KDP29529.1| hypothetical protein JCGZ_19242 [Jatropha curcas] Length = 602 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA+LYP+ DPSRKLLEEVQ NYFLVS VDNDYI+GD+FA+F D+ Sbjct: 556 SRGWASLYPEGDPSRKLLEEVQDNYFLVSLVDNDYIHGDIFAIFADL 602 >ref|XP_006345827.1| PREDICTED: probable methylenetetrahydrofolate reductase-like [Solanum tuberosum] Length = 597 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSR LLE+VQ +YFLVS VDNDYINGDLFA+FKD+ Sbjct: 548 SRGWAQLYPENDPSRTLLEQVQNSYFLVSLVDNDYINGDLFAIFKDM 594 >ref|NP_001289509.1| methylenetetrahydrofolate reductase 2-like [Nicotiana sylvestris] gi|342722657|gb|AEL33269.1| methylenetetrahydrofolate reductase [Nicotiana sylvestris] Length = 595 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +Y+LVS VDNDYINGDLF++F+DI Sbjct: 549 SRGWAQLYPETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFQDI 595 >gb|AEL33267.1| methylenetetrahydrofolate reductase [Nicotiana tabacum] Length = 595 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP++DPSRKLLE+VQ +Y+LVS VDNDYINGDLF++F+DI Sbjct: 549 SRGWAQLYPETDPSRKLLEQVQNSYYLVSLVDNDYINGDLFSIFQDI 595 >ref|XP_002529223.1| methylenetetrahydrofolate reductase, putative [Ricinus communis] gi|223531341|gb|EEF33179.1| methylenetetrahydrofolate reductase, putative [Ricinus communis] Length = 609 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 +RGWA+LYP+SDPSRKLLEEVQ +YFLVS VDNDYI GD+FAVF D+ Sbjct: 563 TRGWASLYPESDPSRKLLEEVQSSYFLVSLVDNDYIQGDIFAVFADL 609 >ref|XP_011074036.1| PREDICTED: probable methylenetetrahydrofolate reductase [Sesamum indicum] Length = 596 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA LYP+ DPSRKL++EVQ Y+LVS VDNDY++GDLFAVFKDI Sbjct: 550 SRGWAKLYPEDDPSRKLIDEVQGKYYLVSLVDNDYVHGDLFAVFKDI 596 >ref|XP_011005230.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Populus euphratica] gi|743922312|ref|XP_011005231.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Populus euphratica] gi|743922314|ref|XP_011005232.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Populus euphratica] gi|743922316|ref|XP_011005233.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Populus euphratica] gi|743922318|ref|XP_011005234.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Populus euphratica] Length = 608 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA+LYP+ DPSR LLEEVQ +YFLVS VDNDYI+GD+FAVF D+ Sbjct: 562 SRGWASLYPEGDPSRTLLEEVQNSYFLVSLVDNDYIHGDIFAVFADL 608 >ref|XP_011004536.1| PREDICTED: methylenetetrahydrofolate reductase 2 [Populus euphratica] Length = 609 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SRGWA+LYP+ DPSR LLEEVQ +YFLVS VDNDYI+GD+FAVF D+ Sbjct: 563 SRGWASLYPEGDPSRTLLEEVQSSYFLVSLVDNDYIHGDIFAVFADL 609 >ref|XP_010251464.1| PREDICTED: methylenetetrahydrofolate reductase 2-like [Nelumbo nucifera] Length = 594 Score = 81.3 bits (199), Expect = 2e-13 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -1 Query: 326 SRGWANLYPDSDPSRKLLEEVQRNYFLVSFVDNDYINGDLFAVFKDI 186 SR WA+LYP+ DPSRKLLEEVQ +FLVS VDNDY+NGDLFAVF DI Sbjct: 548 SRVWASLYPEGDPSRKLLEEVQSGHFLVSLVDNDYVNGDLFAVFSDI 594