BLASTX nr result
ID: Forsythia23_contig00001799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00001799 (386 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012845282.1| PREDICTED: calcium-dependent protein kinase ... 89 2e-15 gb|EPS71343.1| calcium dependent protein kinase 12 [Genlisea aurea] 66 1e-08 gb|ABK79680.2| calcium-dependent protein kinase 2 [Rubia cordifo... 56 8e-06 >ref|XP_012845282.1| PREDICTED: calcium-dependent protein kinase SK5-like [Erythranthe guttatus] gi|848890288|ref|XP_012845283.1| PREDICTED: calcium-dependent protein kinase SK5-like [Erythranthe guttatus] gi|604320039|gb|EYU31203.1| hypothetical protein MIMGU_mgv1a004202mg [Erythranthe guttata] Length = 539 Score = 88.6 bits (218), Expect = 2e-15 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 10/74 (13%) Frame = -3 Query: 192 MSSTSP---------PSKETINQNDTSPSQ-KPTAEIKKPTFMGQHPQKPTWILPYRTPT 43 MSS++P P+ E N++ + +Q KPT EIKKPTF QHPQKPTW+LPYRTP+ Sbjct: 1 MSSSTPSPSSHSHKKPTDENQNEDQKNKAQQKPTPEIKKPTFFTQHPQKPTWVLPYRTPS 60 Query: 42 LQSLYTIGKKLGQG 1 L+SLY+IGKKLGQG Sbjct: 61 LKSLYSIGKKLGQG 74 >gb|EPS71343.1| calcium dependent protein kinase 12 [Genlisea aurea] Length = 516 Score = 65.9 bits (159), Expect = 1e-08 Identities = 36/67 (53%), Positives = 46/67 (68%), Gaps = 3/67 (4%) Frame = -3 Query: 192 MSSTSPPSKETINQNDTSPSQ---KPTAEIKKPTFMGQHPQKPTWILPYRTPTLQSLYTI 22 MSS++PP + P Q KP ++K PTF+ PQKPTWILPYRTP L++LY+I Sbjct: 1 MSSSAPPPPQLDPAAGEPPPQNEHKPKPKLK-PTFI---PQKPTWILPYRTPPLKTLYSI 56 Query: 21 GKKLGQG 1 G+KLGQG Sbjct: 57 GRKLGQG 63 >gb|ABK79680.2| calcium-dependent protein kinase 2 [Rubia cordifolia] Length = 515 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/64 (50%), Positives = 39/64 (60%) Frame = -3 Query: 192 MSSTSPPSKETINQNDTSPSQKPTAEIKKPTFMGQHPQKPTWILPYRTPTLQSLYTIGKK 13 MS+ PP + T P QK E PTF+ KP+W+LPY+T LQSLY+IGKK Sbjct: 1 MSAEPPP-------DPTRPEQKCRGE-PSPTFLS----KPSWVLPYKTQPLQSLYSIGKK 48 Query: 12 LGQG 1 LGQG Sbjct: 49 LGQG 52