BLASTX nr result
ID: Forsythia23_contig00001313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00001313 (472 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW55184.1| hypothetical protein EUGRSUZ_I01134 [Eucalyptus g... 97 5e-18 ref|XP_010028437.1| PREDICTED: caffeoyl-CoA O-methyltransferase ... 97 5e-18 gb|ACY66930.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus ca... 97 5e-18 gb|ACX37697.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus ca... 97 5e-18 gb|ACH47151.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitati... 97 5e-18 gb|AAY89237.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitati... 97 5e-18 sp|O81185.1|CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltrans... 97 5e-18 dbj|BAM05559.1| caffeoyl-CoA O-methyltransferase [Eucalyptus glo... 97 5e-18 dbj|BAM05558.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pil... 97 5e-18 dbj|BAM05557.1| caffeoyl-CoA O-methyltransferase [Eucalyptus glo... 97 5e-18 gb|ADI43381.1| caffeoyl-CoA O-methyltransferase [Eucalyptus cama... 97 5e-18 dbj|BAE48788.1| caffeoyl-CoA-O-methyltransferase [Codonopsis lan... 96 7e-18 gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [Coffea caneph... 96 7e-18 ref|XP_010107916.1| Caffeoyl-CoA O-methyltransferase [Morus nota... 96 9e-18 ref|NP_001268047.1| caffeoyl-CoA O-methyltransferase [Vitis vini... 96 9e-18 ref|XP_009760383.1| PREDICTED: caffeoyl-CoA O-methyltransferase ... 96 9e-18 ref|XP_009600093.1| PREDICTED: caffeoyl-CoA O-methyltransferase ... 96 9e-18 ref|XP_008454948.1| PREDICTED: caffeoyl-CoA O-methyltransferase ... 96 9e-18 gb|ACF17646.1| putative caffeoyl-CoA 3-O-methyltransferase [Caps... 96 9e-18 sp|Q42945.1|CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltrans... 96 9e-18 >gb|KCW55184.1| hypothetical protein EUGRSUZ_I01134 [Eucalyptus grandis] Length = 186 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 141 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 186 >ref|XP_010028437.1| PREDICTED: caffeoyl-CoA O-methyltransferase [Eucalyptus grandis] gi|629088930|gb|KCW55183.1| hypothetical protein EUGRSUZ_I01134 [Eucalyptus grandis] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >gb|ACY66930.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus camaldulensis] Length = 232 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 187 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 232 >gb|ACX37697.1| caffeoyl-CoA O-methyltransferase 1 [Eucalyptus camaldulensis] Length = 232 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 187 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 232 >gb|ACH47151.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum] Length = 247 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247 >gb|AAY89237.1| caffeoyl-CoA 3-O-methyltransferase [Linum usitatissimum] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >sp|O81185.1|CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 1; AltName: Full=Trans-caffeoyl-CoA 3-O-methyltransferase 1; Short=CCoAMT-1; Short=CCoAOMT-1 [Eucalyptus globulus] gi|3319278|gb|AAC26191.1| caffeoyl-CoA 3-O-methyltransferase [Eucalyptus globulus] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >dbj|BAM05559.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. globulus] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >dbj|BAM05558.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pilularis] gi|383081813|dbj|BAM05560.1| caffeoyl-CoA O-methyltransferase [Eucalyptus pyrocarpa] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >dbj|BAM05557.1| caffeoyl-CoA O-methyltransferase [Eucalyptus globulus subsp. globulus] Length = 247 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247 >gb|ADI43381.1| caffeoyl-CoA O-methyltransferase [Eucalyptus camaldulensis] Length = 246 Score = 96.7 bits (239), Expect = 5e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 201 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 246 >dbj|BAE48788.1| caffeoyl-CoA-O-methyltransferase [Codonopsis lanceolata] Length = 247 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 247 >gb|ABO77959.1| caffeoyl-CoA 3-O methyltransferase [Coffea canephora] gi|661899199|emb|CDO97193.1| unnamed protein product [Coffea canephora] Length = 247 Score = 96.3 bits (238), Expect = 7e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 247 >ref|XP_010107916.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis] gi|587930187|gb|EXC17316.1| Caffeoyl-CoA O-methyltransferase [Morus notabilis] Length = 247 Score = 95.9 bits (237), Expect = 9e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRV+ Sbjct: 202 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVN 247 >ref|NP_001268047.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera] gi|3023437|sp|Q43237.1|CAMT_VITVI RecName: Full=Caffeoyl-CoA O-methyltransferase; AltName: Full=Trans-caffeoyl-CoA 3-O-methyltransferase; Short=CCOAMT; Short=CCOAOMT gi|1000519|emb|CAA90969.1| caffeoyl-CoA O-methyltransferase [Vitis vinifera] gi|147853782|emb|CAN79561.1| hypothetical protein VITISV_021020 [Vitis vinifera] Length = 242 Score = 95.9 bits (237), Expect = 9e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 197 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRLS 242 >ref|XP_009760383.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana sylvestris] Length = 247 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247 >ref|XP_009600093.1| PREDICTED: caffeoyl-CoA O-methyltransferase 6 [Nicotiana tomentosiformis] Length = 247 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247 >ref|XP_008454948.1| PREDICTED: caffeoyl-CoA O-methyltransferase 5 [Cucumis melo] Length = 249 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 204 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 249 >gb|ACF17646.1| putative caffeoyl-CoA 3-O-methyltransferase [Capsicum annuum] Length = 247 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247 >sp|Q42945.1|CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 6; AltName: Full=Trans-caffeoyl-CoA 3-O-methyltransferase 6; Short=CCoAMT-6; Short=CCoAOMT-6 [Nicotiana tabacum] gi|1103487|emb|CAA91228.1| caffeoyl-CoA O-methyltransferase [Nicotiana tabacum] Length = 247 Score = 95.9 bits (237), Expect = 9e-18 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -3 Query: 470 DAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRVS 333 DAP+RKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRR+S Sbjct: 202 DAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRIS 247