BLASTX nr result
ID: Forsythia23_contig00000670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00000670 (363 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280895.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 105 9e-21 emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] 105 9e-21 ref|NP_189865.1| protein alfin-like 3 [Arabidopsis thaliana] gi|... 104 2e-20 ref|XP_010474299.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 104 2e-20 ref|XP_010425798.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 104 2e-20 ref|XP_010514705.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [... 104 2e-20 ref|XP_010503019.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-l... 104 2e-20 ref|XP_009386779.1| PREDICTED: PHD finger protein ALFIN-LIKE 8-l... 104 2e-20 ref|XP_009386778.1| PREDICTED: PHD finger protein ALFIN-LIKE 8-l... 104 2e-20 gb|ABA18096.1| PHD finger/nucleic acid binding protein [Olimarab... 104 2e-20 ref|XP_006836943.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 104 2e-20 ref|XP_006291731.1| hypothetical protein CARUB_v10017900mg [Caps... 104 2e-20 ref|XP_002877256.1| PHD finger family protein [Arabidopsis lyrat... 104 2e-20 ref|XP_011079863.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 104 3e-20 ref|XP_006453030.1| hypothetical protein CICLE_v10009272mg [Citr... 104 3e-20 ref|XP_007024569.1| ALF domain class transcription factor [Theob... 104 3e-20 ref|XP_004303478.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 104 3e-20 ref|XP_006474467.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 104 3e-20 ref|XP_012570721.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 103 3e-20 ref|XP_012443091.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 i... 103 3e-20 >ref|XP_002280895.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Vitis vinifera] gi|296081695|emb|CBI20700.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 105 bits (263), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 210 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 253 >emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] Length = 912 Score = 105 bits (263), Expect = 9e-21 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 869 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 912 >ref|NP_189865.1| protein alfin-like 3 [Arabidopsis thaliana] gi|75264588|sp|Q9M2B4.1|ALFL3_ARATH RecName: Full=PHD finger protein ALFIN-LIKE 3; Short=Protein AL3; Contains: RecName: Full=PHD finger protein ALFIN-LIKE 3, N-terminally processed gi|7543887|emb|CAB87196.1| nucleic acid binding protein-like [Arabidopsis thaliana] gi|17065550|gb|AAL32929.1| nucleic acid binding protein-like [Arabidopsis thaliana] gi|21386979|gb|AAM47893.1| nucleic acid binding protein-like [Arabidopsis thaliana] gi|332644231|gb|AEE77752.1| protein alfin-like 3 [Arabidopsis thaliana] Length = 250 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 207 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 250 >ref|XP_010474299.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Camelina sativa] gi|727637780|ref|XP_010490070.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Camelina sativa] Length = 217 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 174 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 217 >ref|XP_010425798.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Camelina sativa] Length = 253 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 210 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 253 >ref|XP_010514705.1| PREDICTED: PHD finger protein ALFIN-LIKE 3 [Camelina sativa] Length = 253 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 210 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 253 >ref|XP_010503019.1| PREDICTED: PHD finger protein ALFIN-LIKE 3-like [Camelina sativa] Length = 253 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 210 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 253 >ref|XP_009386779.1| PREDICTED: PHD finger protein ALFIN-LIKE 8-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 254 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCDVCE+WFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 211 DEFWICCDVCERWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 254 >ref|XP_009386778.1| PREDICTED: PHD finger protein ALFIN-LIKE 8-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 255 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCDVCE+WFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 212 DEFWICCDVCERWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 255 >gb|ABA18096.1| PHD finger/nucleic acid binding protein [Olimarabidopsis pumila] Length = 252 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 209 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 252 >ref|XP_006836943.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Amborella trichopoda] gi|548839507|gb|ERM99796.1| hypothetical protein AMTR_s00099p00155940 [Amborella trichopoda] Length = 257 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCP+CSNKRARA Sbjct: 214 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPNCSNKRARA 257 >ref|XP_006291731.1| hypothetical protein CARUB_v10017900mg [Capsella rubella] gi|482560438|gb|EOA24629.1| hypothetical protein CARUB_v10017900mg [Capsella rubella] Length = 252 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 209 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 252 >ref|XP_002877256.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297323094|gb|EFH53515.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 250 Score = 104 bits (260), Expect = 2e-20 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 132 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA Sbjct: 207 DEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARA 250 >ref|XP_011079863.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Sesamum indicum] gi|747042703|ref|XP_011079870.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Sesamum indicum] Length = 250 Score = 104 bits (259), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 207 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 249 >ref|XP_006453030.1| hypothetical protein CICLE_v10009272mg [Citrus clementina] gi|557556256|gb|ESR66270.1| hypothetical protein CICLE_v10009272mg [Citrus clementina] gi|641854793|gb|KDO73587.1| hypothetical protein CISIN_1g025377mg [Citrus sinensis] Length = 253 Score = 104 bits (259), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 210 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 252 >ref|XP_007024569.1| ALF domain class transcription factor [Theobroma cacao] gi|508779935|gb|EOY27191.1| ALF domain class transcription factor [Theobroma cacao] Length = 252 Score = 104 bits (259), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 209 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 251 >ref|XP_004303478.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Fragaria vesca subsp. vesca] Length = 253 Score = 104 bits (259), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 210 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 252 >ref|XP_006474467.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Citrus sinensis] gi|343887303|dbj|BAK61849.1| PHD finger protein [Citrus unshiu] Length = 253 Score = 104 bits (259), Expect = 3e-20 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 210 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 252 >ref|XP_012570721.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X2 [Cicer arietinum] Length = 257 Score = 103 bits (258), Expect = 3e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 214 DEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 256 >ref|XP_012443091.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 isoform X1 [Gossypium raimondii] Length = 255 Score = 103 bits (258), Expect = 3e-20 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +1 Query: 1 DEFWICCDVCEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 129 DEFWICCD+CEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR Sbjct: 212 DEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 254