BLASTX nr result
ID: Forsythia23_contig00000587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00000587 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074040.1| PREDICTED: uncharacterized protein LOC105158... 57 4e-06 >ref|XP_011074040.1| PREDICTED: uncharacterized protein LOC105158818 [Sesamum indicum] Length = 544 Score = 57.4 bits (137), Expect = 4e-06 Identities = 37/89 (41%), Positives = 53/89 (59%), Gaps = 10/89 (11%) Frame = -1 Query: 239 LIHAPTYRNPI-QNSNPTRFTIHYSQKP----SIQLSLNW-----SRAGDILRQITISSV 90 ++ P+ PI + NPTR I + P SIQL+ + S AGD RQ+++SSV Sbjct: 3 VLSLPSLPGPICSDLNPTRTWIRTPRYPPRRLSIQLTATFNNNRCSSAGDFFRQLSVSSV 62 Query: 89 LFLGLSINGFWAFAPSASARMLPSTSPSS 3 + +GL ++ WAF P ASAR+ P+ SPSS Sbjct: 63 VLIGLGLSSLWAFPPPASARIRPA-SPSS 90