BLASTX nr result
ID: Forsythia22_contig00065224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00065224 (279 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64303.1| hypothetical protein VITISV_034923 [Vitis vinifera] 62 1e-07 ref|XP_003614106.1| hypothetical protein MTR_5g044850 [Medicago ... 61 3e-07 emb|CAN82791.1| hypothetical protein VITISV_033795 [Vitis vinifera] 60 7e-07 >emb|CAN64303.1| hypothetical protein VITISV_034923 [Vitis vinifera] Length = 600 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +3 Query: 135 VVFQPE*VFNVGIILAKSNYDIWSQLKEMQIVEQDKISYICCKTKP 272 +VFQ E FN IILA+SNYD+WS L EM IV+Q+K+SYI KTKP Sbjct: 7 IVFQSEGTFNPRIILAESNYDVWSHLVEMYIVKQEKLSYIRGKTKP 52 >ref|XP_003614106.1| hypothetical protein MTR_5g044850 [Medicago truncatula] Length = 78 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +3 Query: 132 PVVFQPE*VFNVGIILAKSNYDIWSQLKEMQIVEQDKISYICCKTK 269 PVV Q E VFN GI+L +SNYD+WSQL EM I E++K+SYI K K Sbjct: 15 PVVVQSEGVFNAGIVLDESNYDVWSQLMEMHIAEREKLSYIRGKMK 60 >emb|CAN82791.1| hypothetical protein VITISV_033795 [Vitis vinifera] Length = 314 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 135 VVFQPE*VFNVGIILAKSNYDIWSQLKEMQIVEQDKISYICCKT 266 +VFQ E FN GIIL +SNYD+WSQL EM I E++K+SYI KT Sbjct: 7 IVFQSEGTFNPGIILTESNYDVWSQLVEMHITEREKLSYIRGKT 50