BLASTX nr result
ID: Forsythia22_contig00065193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00065193 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084486.1| PREDICTED: transcription factor SPEECHLESS-l... 77 3e-12 ref|XP_008234779.1| PREDICTED: transcription factor SPEECHLESS [... 76 8e-12 ref|XP_007219087.1| hypothetical protein PRUPE_ppa015055mg [Prun... 76 8e-12 ref|XP_010266461.1| PREDICTED: transcription factor SPEECHLESS-l... 76 1e-11 ref|XP_004965509.1| PREDICTED: transcription factor SPEECHLESS-l... 76 1e-11 ref|XP_008659639.1| PREDICTED: transcription factor SPEECHLESS-l... 76 1e-11 ref|XP_002437061.1| hypothetical protein SORBIDRAFT_10g020490 [S... 76 1e-11 ref|XP_010024801.1| PREDICTED: transcription factor SPEECHLESS [... 75 1e-11 emb|CDP05093.1| unnamed protein product [Coffea canephora] 75 1e-11 gb|KCW90561.1| hypothetical protein EUGRSUZ_A02667 [Eucalyptus g... 75 1e-11 ref|XP_007038955.1| Basic helix-loop-helix DNA-binding superfami... 75 1e-11 ref|XP_011007925.1| PREDICTED: transcription factor SPEECHLESS-l... 75 2e-11 ref|XP_010915684.1| PREDICTED: transcription factor SPEECHLESS [... 75 2e-11 ref|XP_010537121.1| PREDICTED: transcription factor SPEECHLESS [... 75 2e-11 ref|XP_010261507.1| PREDICTED: transcription factor SPEECHLESS-l... 75 2e-11 ref|XP_008783959.1| PREDICTED: transcription factor SPEECHLESS [... 75 2e-11 ref|XP_006374334.1| hypothetical protein POPTR_0015s06160g [Popu... 75 2e-11 ref|XP_004309160.1| PREDICTED: transcription factor SPEECHLESS [... 75 2e-11 ref|XP_003602194.1| Transcription factor SPEECHLESS [Medicago tr... 75 2e-11 ref|XP_012090117.1| PREDICTED: transcription factor SPEECHLESS [... 74 3e-11 >ref|XP_011084486.1| PREDICTED: transcription factor SPEECHLESS-like [Sesamum indicum] Length = 348 Score = 77.4 bits (189), Expect = 3e-12 Identities = 47/84 (55%), Positives = 48/84 (57%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAYTEV Sbjct: 142 FYVKRGDQASIIGGVVDYIHELQQVLQSLEAKKQRKAYTEV----LSPRPVSSPRPLPLS 197 Query: 73 XXXXXXXXXXXXXXPQPNSPYKTW 2 PQP+SPYK W Sbjct: 198 PRKPPLSQPISPSTPQPSSPYKPW 221 >ref|XP_008234779.1| PREDICTED: transcription factor SPEECHLESS [Prunus mume] Length = 269 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAY+EV Sbjct: 28 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKAYSEV 68 >ref|XP_007219087.1| hypothetical protein PRUPE_ppa015055mg [Prunus persica] gi|462415549|gb|EMJ20286.1| hypothetical protein PRUPE_ppa015055mg [Prunus persica] Length = 388 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAY+EV Sbjct: 149 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKAYSEV 189 >ref|XP_010266461.1| PREDICTED: transcription factor SPEECHLESS-like [Nelumbo nucifera] Length = 357 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAY+EV Sbjct: 150 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKAYSEV 190 >ref|XP_004965509.1| PREDICTED: transcription factor SPEECHLESS-like [Setaria italica] Length = 386 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTE 134 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAYTE Sbjct: 138 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKAYTE 177 >ref|XP_008659639.1| PREDICTED: transcription factor SPEECHLESS-like [Zea mays] gi|413954172|gb|AFW86821.1| putative HLH DNA-binding domain superfamily protein [Zea mays] Length = 362 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTE 134 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAYTE Sbjct: 127 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKAYTE 166 >ref|XP_002437061.1| hypothetical protein SORBIDRAFT_10g020490 [Sorghum bicolor] gi|241915284|gb|EER88428.1| hypothetical protein SORBIDRAFT_10g020490 [Sorghum bicolor] Length = 380 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTE 134 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRKAYTE Sbjct: 138 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKAYTE 177 >ref|XP_010024801.1| PREDICTED: transcription factor SPEECHLESS [Eucalyptus grandis] Length = 337 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI+ELQQ+LQSLEAKKQRKAY+EV Sbjct: 122 FYVKRGDQASIIGGVVDYISELQQLLQSLEAKKQRKAYSEV 162 >emb|CDP05093.1| unnamed protein product [Coffea canephora] Length = 338 Score = 75.5 bits (184), Expect = 1e-11 Identities = 44/82 (53%), Positives = 46/82 (56%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 144 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYSEVLSPRLVSSPRSSPLSPRKP 203 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP+SPYK Sbjct: 204 PLSPRLSLPISPRTPQPSSPYK 225 >gb|KCW90561.1| hypothetical protein EUGRSUZ_A02667 [Eucalyptus grandis] Length = 338 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI+ELQQ+LQSLEAKKQRKAY+EV Sbjct: 127 FYVKRGDQASIIGGVVDYISELQQLLQSLEAKKQRKAYSEV 167 >ref|XP_007038955.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] gi|508776200|gb|EOY23456.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] Length = 331 Score = 75.5 bits (184), Expect = 1e-11 Identities = 44/82 (53%), Positives = 46/82 (56%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 130 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYSEVLSPRIVSSPRPSPLSPRKP 189 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP+SPYK Sbjct: 190 PLSPRINLPISPRTPQPSSPYK 211 >ref|XP_011007925.1| PREDICTED: transcription factor SPEECHLESS-like [Populus euphratica] Length = 345 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 142 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYSEV 182 >ref|XP_010915684.1| PREDICTED: transcription factor SPEECHLESS [Elaeis guineensis] Length = 339 Score = 74.7 bits (182), Expect = 2e-11 Identities = 44/82 (53%), Positives = 45/82 (54%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 142 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKVYSEVLSPRPVSSPRTTPLSPRPP 201 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP SPYK Sbjct: 202 PLSPRKGLPVSPRTPQPGSPYK 223 >ref|XP_010537121.1| PREDICTED: transcription factor SPEECHLESS [Tarenaya hassleriana] Length = 362 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVV+YI+ELQQVLQSLEAKKQRKAY EV Sbjct: 126 FYVKRGDQASIIGGVVEYISELQQVLQSLEAKKQRKAYAEV 166 >ref|XP_010261507.1| PREDICTED: transcription factor SPEECHLESS-like [Nelumbo nucifera] gi|720017576|ref|XP_010261508.1| PREDICTED: transcription factor SPEECHLESS-like [Nelumbo nucifera] Length = 350 Score = 74.7 bits (182), Expect = 2e-11 Identities = 44/82 (53%), Positives = 45/82 (54%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 144 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKVYSEVLSPRLVSSPRPSPLSPRKP 203 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP SPYK Sbjct: 204 PLSPRVSLPISPRTPQPGSPYK 225 >ref|XP_008783959.1| PREDICTED: transcription factor SPEECHLESS [Phoenix dactylifera] Length = 338 Score = 74.7 bits (182), Expect = 2e-11 Identities = 44/82 (53%), Positives = 45/82 (54%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 141 FYVKRGDQASIIGGVVDYIKELQQVLQSLEAKKQRKVYSEVLSPRPVSSPRTTPLSPRPP 200 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP SPYK Sbjct: 201 PLSPRKGLPISPRTPQPGSPYK 222 >ref|XP_006374334.1| hypothetical protein POPTR_0015s06160g [Populus trichocarpa] gi|550322093|gb|ERP52131.1| hypothetical protein POPTR_0015s06160g [Populus trichocarpa] Length = 303 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQVLQSLEAKKQRK Y+EV Sbjct: 125 FYVKRGDQASIIGGVVDYINELQQVLQSLEAKKQRKVYSEV 165 >ref|XP_004309160.1| PREDICTED: transcription factor SPEECHLESS [Fragaria vesca subsp. vesca] Length = 366 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVV+YI ELQQVLQSLEAKKQRKAY+EV Sbjct: 131 FYVKRGDQASIIGGVVEYINELQQVLQSLEAKKQRKAYSEV 171 >ref|XP_003602194.1| Transcription factor SPEECHLESS [Medicago truncatula] gi|355491242|gb|AES72445.1| transcription factor [Medicago truncatula] Length = 329 Score = 74.7 bits (182), Expect = 2e-11 Identities = 43/82 (52%), Positives = 46/82 (56%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEVXXXXXXXXXXXXXXXXXXX 74 FYVKR DQASIIGGVVDYITELQQ+LQ+LEAKKQRK Y+EV Sbjct: 128 FYVKRGDQASIIGGVVDYITELQQLLQALEAKKQRKVYSEVLSPRLVPSPRPSPLSPRKP 187 Query: 73 XXXXXXXXXXXXXXPQPNSPYK 8 PQP SPYK Sbjct: 188 PLSPRLNLPISPRTPQPTSPYK 209 >ref|XP_012090117.1| PREDICTED: transcription factor SPEECHLESS [Jatropha curcas] Length = 336 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 253 FYVKRADQASIIGGVVDYITELQQVLQSLEAKKQRKAYTEV 131 FYVKR DQASIIGGVVDYI ELQQ+LQSLEAKKQRK Y+EV Sbjct: 131 FYVKRGDQASIIGGVVDYINELQQILQSLEAKKQRKVYSEV 171