BLASTX nr result
ID: Forsythia22_contig00065021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00065021 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835990.1| PREDICTED: nuclear pore complex protein DDB_... 59 1e-06 gb|EYU38512.1| hypothetical protein MIMGU_mgv1a001859mg [Erythra... 59 1e-06 >ref|XP_012835990.1| PREDICTED: nuclear pore complex protein DDB_G0274915 [Erythranthe guttatus] Length = 754 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/76 (39%), Positives = 48/76 (63%) Frame = -3 Query: 228 IEEFERIDRQTNALSLMDPDYQFSENQTEPTTLQLSGSMGAQKEVFVTINGDGNDQLPEL 49 +E + ID + +L+D D QFSENQ + +L+G + + K+ +++ D +D+LPEL Sbjct: 1 MEGCQNIDLEIEGHALID-DNQFSENQAGFSNCELAGGLSSDKDFDISLGMDADDRLPEL 59 Query: 48 REWTEPQSSQRNGRCN 1 E EPQ +Q+NGR N Sbjct: 60 NESIEPQRNQKNGRYN 75 >gb|EYU38512.1| hypothetical protein MIMGU_mgv1a001859mg [Erythranthe guttata] Length = 748 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/76 (39%), Positives = 48/76 (63%) Frame = -3 Query: 228 IEEFERIDRQTNALSLMDPDYQFSENQTEPTTLQLSGSMGAQKEVFVTINGDGNDQLPEL 49 +E + ID + +L+D D QFSENQ + +L+G + + K+ +++ D +D+LPEL Sbjct: 1 MEGCQNIDLEIEGHALID-DNQFSENQAGFSNCELAGGLSSDKDFDISLGMDADDRLPEL 59 Query: 48 REWTEPQSSQRNGRCN 1 E EPQ +Q+NGR N Sbjct: 60 NESIEPQRNQKNGRYN 75