BLASTX nr result
ID: Forsythia22_contig00064475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00064475 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006495009.1| PREDICTED: uncharacterized protein LOC102608... 59 2e-06 >ref|XP_006495009.1| PREDICTED: uncharacterized protein LOC102608416 [Citrus sinensis] Length = 1313 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/49 (51%), Positives = 32/49 (65%) Frame = +1 Query: 256 KYAGQEDLDDHLLNYNASMGIAGAIPALKCKAFPLTLEGSALRWYKKLP 402 KY+GQ D H+ +N G+ G PA +C+ FPLTLEG A WY+KLP Sbjct: 27 KYSGQSDPLVHIERFNDMTGVQGLTPAQRCRVFPLTLEGRAREWYRKLP 75