BLASTX nr result
ID: Forsythia22_contig00064414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00064414 (239 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098427.1| PREDICTED: denticleless protein homolog A is... 62 1e-07 >ref|XP_011098427.1| PREDICTED: denticleless protein homolog A isoform X1 [Sesamum indicum] gi|747100654|ref|XP_011098428.1| PREDICTED: denticleless protein homolog A isoform X2 [Sesamum indicum] Length = 543 Score = 62.0 bits (149), Expect = 1e-07 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -1 Query: 239 VSTPESQEKRVSCNSEVKVNLEKTPEAEMKXXXXXXXXXXXLKRKTIRDYFLVS 78 VSTPESQ+K+ S + EVK NLE+TPEAEMK LKRKTIRDYF VS Sbjct: 490 VSTPESQKKKFSMSFEVKENLERTPEAEMKSPSSVLNPPSSLKRKTIRDYFPVS 543