BLASTX nr result
ID: Forsythia22_contig00064397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00064397 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12143.1| unnamed protein product [Coffea canephora] 86 8e-15 ref|XP_011101029.1| PREDICTED: uncharacterized protein LOC105179... 86 1e-14 ref|XP_007209796.1| hypothetical protein PRUPE_ppa013941mg [Prun... 84 3e-14 gb|EPS62431.1| hypothetical protein M569_12360 [Genlisea aurea] 84 4e-14 ref|XP_009767929.1| PREDICTED: uncharacterized protein LOC104219... 82 2e-13 ref|XP_009352396.1| PREDICTED: uncharacterized protein LOC103943... 82 2e-13 gb|KDO76499.1| hypothetical protein CISIN_1g038903mg [Citrus sin... 82 2e-13 ref|XP_006439369.1| hypothetical protein CICLE_v10024283mg [Citr... 82 2e-13 ref|XP_009797966.1| PREDICTED: uncharacterized protein LOC104244... 81 2e-13 ref|XP_010541539.1| PREDICTED: uncharacterized protein LOC104814... 81 3e-13 gb|KJB52276.1| hypothetical protein B456_008G253500 [Gossypium r... 80 4e-13 ref|XP_012439760.1| PREDICTED: subtilisin-like protease SBT2.5 i... 80 4e-13 gb|KHG11910.1| Diaminopimelate epimerase [Gossypium arboreum] 80 4e-13 ref|XP_009603674.1| PREDICTED: uncharacterized protein LOC104098... 80 4e-13 ref|XP_008381197.1| PREDICTED: uncharacterized protein LOC103444... 80 4e-13 ref|XP_009619288.1| PREDICTED: uncharacterized protein LOC104111... 79 1e-12 ref|XP_010096818.1| hypothetical protein L484_003879 [Morus nota... 79 2e-12 ref|XP_007040493.1| PA-domain containing subtilase family protei... 78 2e-12 ref|XP_002272604.1| PREDICTED: uncharacterized protein LOC100258... 78 2e-12 ref|XP_012086743.1| PREDICTED: subtilisin-like protease SBT2.5 i... 78 3e-12 >emb|CDP12143.1| unnamed protein product [Coffea canephora] Length = 95 Score = 86.3 bits (212), Expect = 8e-15 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 D LA LEPGSY+KTLSLVIVDGFAVEITD+QANVLRSA +VR+VEKNQEL Sbjct: 44 DLLANTLEPGSYKKTLSLVIVDGFAVEITDDQANVLRSAKDVRLVEKNQEL 94 >ref|XP_011101029.1| PREDICTED: uncharacterized protein LOC105179129 [Sesamum indicum] Length = 95 Score = 85.5 bits (210), Expect = 1e-14 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LAKNL+ G+Y KTLSLVIVDGFAVEITD+QANVLRSA EVRIVEKNQEL Sbjct: 44 EVLAKNLQAGTYRKTLSLVIVDGFAVEITDDQANVLRSAEEVRIVEKNQEL 94 >ref|XP_007209796.1| hypothetical protein PRUPE_ppa013941mg [Prunus persica] gi|645267389|ref|XP_008239047.1| PREDICTED: uncharacterized protein LOC103337657 [Prunus mume] gi|462405531|gb|EMJ10995.1| hypothetical protein PRUPE_ppa013941mg [Prunus persica] Length = 95 Score = 84.3 bits (207), Expect = 3e-14 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = -3 Query: 253 LAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 LA+ LEPGSY+KTLSLVIVDGFAVEITD+QA+VLRSA EVR+VEKNQEL Sbjct: 46 LARTLEPGSYKKTLSLVIVDGFAVEITDDQASVLRSAKEVRLVEKNQEL 94 >gb|EPS62431.1| hypothetical protein M569_12360 [Genlisea aurea] Length = 94 Score = 84.0 bits (206), Expect = 4e-14 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LAKNL+PG+Y KTLSLVIVDGFAVEI+++QANVLR+A EVRIVEKNQEL Sbjct: 43 EILAKNLQPGTYNKTLSLVIVDGFAVEISEDQANVLRAAKEVRIVEKNQEL 93 >ref|XP_009767929.1| PREDICTED: uncharacterized protein LOC104219001 [Nicotiana sylvestris] Length = 95 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA EPGSY+K LSLVIVDGFAVEITD+QANVLRSA EVR+VEKNQEL Sbjct: 44 ELLANTFEPGSYKKRLSLVIVDGFAVEITDDQANVLRSAPEVRVVEKNQEL 94 >ref|XP_009352396.1| PREDICTED: uncharacterized protein LOC103943773 [Pyrus x bretschneideri] gi|694445180|ref|XP_009349051.1| PREDICTED: uncharacterized protein LOC103940627 isoform X1 [Pyrus x bretschneideri] Length = 95 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = -3 Query: 253 LAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 LA+ LEPGSY+KTLSLVIVDGF+VEIT++QA+VLRSA EVR+VEKNQEL Sbjct: 46 LARTLEPGSYKKTLSLVIVDGFSVEITEDQASVLRSAKEVRLVEKNQEL 94 >gb|KDO76499.1| hypothetical protein CISIN_1g038903mg [Citrus sinensis] Length = 95 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA LEPGSY KTLSLVIVDGFAVEIT++QANVLRSA VR+VEKNQEL Sbjct: 44 ELLASTLEPGSYRKTLSLVIVDGFAVEITEDQANVLRSAKGVRVVEKNQEL 94 >ref|XP_006439369.1| hypothetical protein CICLE_v10024283mg [Citrus clementina] gi|557541631|gb|ESR52609.1| hypothetical protein CICLE_v10024283mg [Citrus clementina] Length = 95 Score = 81.6 bits (200), Expect = 2e-13 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA LEPGSY KTLSLVIVDGFAVEIT++QANVLRSA VR+VEKNQEL Sbjct: 44 ELLASTLEPGSYRKTLSLVIVDGFAVEITEDQANVLRSAKGVRVVEKNQEL 94 >ref|XP_009797966.1| PREDICTED: uncharacterized protein LOC104244276 [Nicotiana sylvestris] Length = 94 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + L LEPGSY KT+SLVIVDGFAVEITD QANVLRSA +VR+VEKNQEL Sbjct: 43 ELLENTLEPGSYNKTMSLVIVDGFAVEITDNQANVLRSAKDVRVVEKNQEL 93 >ref|XP_010541539.1| PREDICTED: uncharacterized protein LOC104814970 [Tarenaya hassleriana] Length = 97 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + L++NLEPGSY KTLSL+IVDGFAVEIT++QANVLRSA VR+VEKNQE+ Sbjct: 46 EVLSRNLEPGSYTKTLSLLIVDGFAVEITEDQANVLRSAEGVRLVEKNQEV 96 >gb|KJB52276.1| hypothetical protein B456_008G253500 [Gossypium raimondii] Length = 81 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA L+PG+Y KTLSLVIVDGFAVEIT+ QANVLRSAN VR+VEKNQEL Sbjct: 30 ELLASTLQPGTYRKTLSLVIVDGFAVEITEAQANVLRSANGVRVVEKNQEL 80 >ref|XP_012439760.1| PREDICTED: subtilisin-like protease SBT2.5 isoform X1 [Gossypium raimondii] gi|763785204|gb|KJB52275.1| hypothetical protein B456_008G253500 [Gossypium raimondii] Length = 95 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA L+PG+Y KTLSLVIVDGFAVEIT+ QANVLRSAN VR+VEKNQEL Sbjct: 44 ELLASTLQPGTYRKTLSLVIVDGFAVEITEAQANVLRSANGVRVVEKNQEL 94 >gb|KHG11910.1| Diaminopimelate epimerase [Gossypium arboreum] Length = 95 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA L+PG+Y KTLSLVIVDGFAVEIT+ QANVLRSAN VR+VEKNQEL Sbjct: 44 ELLASTLQPGTYRKTLSLVIVDGFAVEITEAQANVLRSANGVRVVEKNQEL 94 >ref|XP_009603674.1| PREDICTED: uncharacterized protein LOC104098595 [Nicotiana tomentosiformis] Length = 95 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA EPGSY+K LSLVIVDGFAVEITD+QA+VLRSA EVR+VEKNQEL Sbjct: 44 ELLANTFEPGSYKKRLSLVIVDGFAVEITDDQADVLRSAKEVRVVEKNQEL 94 >ref|XP_008381197.1| PREDICTED: uncharacterized protein LOC103444066 isoform X1 [Malus domestica] Length = 95 Score = 80.5 bits (197), Expect = 4e-13 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -3 Query: 253 LAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 LA+ L+PGSY+KTLSLVIVDGF+VEIT++QA+VLRSA EVR+VEKNQEL Sbjct: 46 LARTLDPGSYKKTLSLVIVDGFSVEITEDQASVLRSAKEVRLVEKNQEL 94 >ref|XP_009619288.1| PREDICTED: uncharacterized protein LOC104111317 [Nicotiana tomentosiformis] Length = 94 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + L LEPGSY KT+SLVIVDGFAVE+TD QAN+LRSA +VR+VEKNQEL Sbjct: 43 ELLENTLEPGSYNKTMSLVIVDGFAVEMTDHQANLLRSAKDVRVVEKNQEL 93 >ref|XP_010096818.1| hypothetical protein L484_003879 [Morus notabilis] gi|587877006|gb|EXB66078.1| hypothetical protein L484_003879 [Morus notabilis] Length = 95 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA LEPGSY KTLSLVIVDGF+VEITDEQA +LRSA VR+VEKNQEL Sbjct: 44 ELLASALEPGSYNKTLSLVIVDGFSVEITDEQAKMLRSAKGVRLVEKNQEL 94 >ref|XP_007040493.1| PA-domain containing subtilase family protein [Theobroma cacao] gi|508777738|gb|EOY24994.1| PA-domain containing subtilase family protein [Theobroma cacao] Length = 95 Score = 78.2 bits (191), Expect = 2e-12 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA L+ GSY+KTLSLVIVDGFAVEIT+ QANVLRSAN VR+VEKNQEL Sbjct: 44 ELLAGTLQAGSYKKTLSLVIVDGFAVEITEAQANVLRSANGVRVVEKNQEL 94 >ref|XP_002272604.1| PREDICTED: uncharacterized protein LOC100258722 [Vitis vinifera] gi|147843398|emb|CAN82078.1| hypothetical protein VITISV_042760 [Vitis vinifera] gi|297742319|emb|CBI34468.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 78.2 bits (191), Expect = 2e-12 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -3 Query: 253 LAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 LA LEPGSY+KT SLVIVDGFAVEI+D+QANVLRSA VR+VEKNQEL Sbjct: 46 LASVLEPGSYKKTSSLVIVDGFAVEISDDQANVLRSAKGVRVVEKNQEL 94 >ref|XP_012086743.1| PREDICTED: subtilisin-like protease SBT2.5 isoform X3 [Jatropha curcas] Length = 93 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -3 Query: 259 DALAKNLEPGSYEKTLSLVIVDGFAVEITDEQANVLRSANEVRIVEKNQEL 107 + LA NL+ G+Y KTLSLVIVDGFAVEIT+ QANVLRSAN VR+VEKNQE+ Sbjct: 42 ELLANNLDRGTYRKTLSLVIVDGFAVEITEVQANVLRSANGVRVVEKNQEV 92