BLASTX nr result
ID: Forsythia22_contig00064237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00064237 (394 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080431.1| PREDICTED: girdin-like [Sesamum indicum] 58 3e-06 >ref|XP_011080431.1| PREDICTED: girdin-like [Sesamum indicum] Length = 567 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 337 VAPKQSPLRDIGNMSPLVRQYSKAIFPLQSPESCKMKEGFRK 212 +A ++SPLRDIGN SPL RQ+S++ FP SPES + +E FRK Sbjct: 526 IATERSPLRDIGNSSPLARQHSRSAFPFHSPESSRTRESFRK 567