BLASTX nr result
ID: Forsythia22_contig00063729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063729 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083799.1| PREDICTED: CST complex subunit CTC1 [Sesamum... 69 9e-10 >ref|XP_011083799.1| PREDICTED: CST complex subunit CTC1 [Sesamum indicum] Length = 1365 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/73 (45%), Positives = 42/73 (57%) Frame = -1 Query: 222 SSYSSHNISVEDKCCFKNLLEYTCFVASESVNYHCAGVLRCSKSDAEVVSGCKPHMRKVL 43 S + N+ C LLE C VAS+ VN HC L C+ A++VSGC RKVL Sbjct: 784 SCCADRNLYTGQTCISNQLLELPCLVASKGVNSHCLATLCCTIEQAKIVSGCVLPRRKVL 843 Query: 42 LEFNSDSFCTYQI 4 LEF+ DSFC Y++ Sbjct: 844 LEFSPDSFCMYEV 856