BLASTX nr result
ID: Forsythia22_contig00063687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063687 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088217.1| PREDICTED: cyclin-D3-1 [Sesamum indicum] 60 7e-07 >ref|XP_011088217.1| PREDICTED: cyclin-D3-1 [Sesamum indicum] Length = 372 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/46 (63%), Positives = 34/46 (73%), Gaps = 5/46 (10%) Frame = +2 Query: 8 SWGMASCISSSARQPLLKKRRVQEQQMKLPSLTRVFV-----GSPH 130 SWG+ SC+ SS Q + KKRRVQEQQM+LPSL+RVFV SPH Sbjct: 327 SWGVGSCVCSSPHQTIFKKRRVQEQQMRLPSLSRVFVDAVTGSSPH 372