BLASTX nr result
ID: Forsythia22_contig00063614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063614 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849208.1| PREDICTED: putative cyclin-B3-1 isoform X2 [... 57 4e-06 >ref|XP_012849208.1| PREDICTED: putative cyclin-B3-1 isoform X2 [Erythranthe guttatus] Length = 686 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 129 MVAVKGRLSSLTNRVTQDHKMSNTGRVRNFKIYAEVDNVK 10 MVAVKGRL+ L +RV QD K SN GRV+N KIY EVD VK Sbjct: 1 MVAVKGRLNLLRDRVNQDQKTSNNGRVKNLKIYVEVDKVK 40