BLASTX nr result
ID: Forsythia22_contig00063578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063578 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75033.1| hypothetical protein VITISV_022185 [Vitis vinifera] 49 4e-08 ref|XP_010274494.1| PREDICTED: uncharacterized protein LOC104609... 39 2e-06 ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula] 45 5e-06 gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa] 41 7e-06 >emb|CAN75033.1| hypothetical protein VITISV_022185 [Vitis vinifera] Length = 792 Score = 48.5 bits (114), Expect(2) = 4e-08 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = +1 Query: 157 VFLGYCNSQKSHKYFHPSTRNFFVTMDVQFCKLESFYSEAAPLVHL*REISSRE 318 +F+GY QK ++ +HP+T+ +VTMDV F + E+F+S + L EI E Sbjct: 93 IFVGYATRQKGYRCYHPTTKRTYVTMDVTFLESETFFSSSVSTSSLQGEIRDEE 146 Score = 35.4 bits (80), Expect(2) = 4e-08 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +2 Query: 11 LTIKPPLTVLSQFHSIPSVLKICPKVFGCV 100 L K PL VLS+ S+P+V+ + P++FGCV Sbjct: 43 LQFKTPLQVLSEHVSLPTVVLLPPRIFGCV 72 >ref|XP_010274494.1| PREDICTED: uncharacterized protein LOC104609809 [Nelumbo nucifera] Length = 839 Score = 39.3 bits (90), Expect(3) = 2e-06 Identities = 21/54 (38%), Positives = 29/54 (53%) Frame = +1 Query: 157 VFLGYCNSQKSHKYFHPSTRNFFVTMDVQFCKLESFYSEAAPLVHL*REISSRE 318 +FLGY QK ++ + T +VTMDV F + E+FYS + L E S E Sbjct: 496 IFLGYALHQKGYRCYDLVTHRTYVTMDVTFLESETFYSPSTTNSSLQGESQSEE 549 Score = 37.0 bits (84), Expect(3) = 2e-06 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = +2 Query: 11 LTIKPPLTVLSQFHSIPSVLKICPKVFGCV 100 L K PL LS S+PSVL I P+VFGCV Sbjct: 446 LQFKTPLQALSSHVSLPSVLMIPPRVFGCV 475 Score = 21.2 bits (43), Expect(3) = 2e-06 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 96 VCYVYVDSQLRYKLDHHALKCL 161 V +V++ R KLD A +C+ Sbjct: 475 VAFVHLHQNQRTKLDPRAARCI 496 >ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula] Length = 2260 Score = 45.1 bits (105), Expect(3) = 5e-06 Identities = 18/37 (48%), Positives = 28/37 (75%) Frame = +1 Query: 157 VFLGYCNSQKSHKYFHPSTRNFFVTMDVQFCKLESFY 267 VF+GY +QK +K +HPS++ +FV+MDV F + E F+ Sbjct: 1219 VFVGYSTTQKGYKAYHPSSKKYFVSMDVTFHEHELFF 1255 Score = 27.7 bits (60), Expect(3) = 5e-06 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 11 LTIKPPLTVLSQFHSIPSVLKICPKVFGCVL 103 L + P+ VLS ++ S+ + P +FGCV+ Sbjct: 1169 LNFRRPIDVLSNHCTLNSINNLPPHIFGCVI 1199 Score = 22.7 bits (47), Expect(3) = 5e-06 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 96 VCYVYVDSQLRYKLDHHALKCL 161 V YV++ R KL+ A+KC+ Sbjct: 1198 VIYVHLHPHQRTKLESRAMKCV 1219 >gb|AFP55546.1| gag-pol polyprotein [Rosa rugosa] Length = 1180 Score = 41.2 bits (95), Expect(3) = 7e-06 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = +1 Query: 157 VFLGYCNSQKSHKYFHPSTRNFFVTMDVQF 246 VF+GY + QK +K +HP ++ F+VTMDV F Sbjct: 435 VFVGYGSHQKGYKCYHPQSQKFYVTMDVSF 464 Score = 29.3 bits (64), Expect(3) = 7e-06 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 26 PLTVLSQFHSIPSVLKICPKVFGCV 100 PL VLS + SIPS + +VFGCV Sbjct: 390 PLEVLSNYVSIPSSNTLPARVFGCV 414 Score = 24.6 bits (52), Expect(3) = 7e-06 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 96 VCYVYVDSQLRYKLDHHALKCL 161 V YV++ R KLD ALKC+ Sbjct: 414 VAYVHLYKNQRSKLDARALKCV 435