BLASTX nr result
ID: Forsythia22_contig00063523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063523 (360 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173393.1| hypothetical protein NitaMp047 [Nicotiana tabac... 76 1e-13 >ref|YP_173393.1| hypothetical protein NitaMp047 [Nicotiana tabacum] gi|56806556|dbj|BAD83457.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 132 Score = 76.3 bits (186), Expect(2) = 1e-13 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -2 Query: 158 FRIGIRSSVLILTHHTMPLDACWHTTGRLITTPSTLQLDCSPLGNYTTIEPS 3 FRIGIRSS+ ILTHH+MPLD CW GRLI TPST ++ PLGNYTT EPS Sbjct: 80 FRIGIRSSMFILTHHSMPLDVCWRKKGRLI-TPSTFKVYDFPLGNYTTTEPS 130 Score = 26.6 bits (57), Expect(2) = 1e-13 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 202 ICMLMSVFCQPQSIGF 155 + M MSV CQPQS GF Sbjct: 65 LSMQMSVCCQPQSFGF 80