BLASTX nr result
ID: Forsythia22_contig00063430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063430 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 58 3e-06 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 57.8 bits (138), Expect = 3e-06 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 4/79 (5%) Frame = -1 Query: 277 VNPHEISTEVWKFLSKVGILCLIILFNEFLKIEKMPNEW--TKVETMYKNKVYNPDCKL* 104 V P +I EVWK L + GI LI LFN LK +KMPNEW + + +YKNK +C Sbjct: 182 VGPDDIPIEVWKVLGETGITWLIDLFNRILKTKKMPNEWRTSPLVPIYKNKGDVQNCMNY 241 Query: 103 KSNLMSSHEIK--GEMIEH 53 + + SH +K +IEH Sbjct: 242 RGIKLMSHTMKLWERVIEH 260