BLASTX nr result
ID: Forsythia22_contig00063413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00063413 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101762.1| PREDICTED: ras GTPase-activating protein-bin... 59 1e-06 >ref|XP_011101762.1| PREDICTED: ras GTPase-activating protein-binding protein 1-like [Sesamum indicum] Length = 488 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/71 (47%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = -1 Query: 239 KVFQAHCVTFGEKEAYITYKRS-SNPGRNSQEKFPGRDEIQKRNLRGWENGEGNSNRRFQ 63 + + H V FG+KEAYITYKRS SN G N + P R + N RG EN + N RFQ Sbjct: 397 RAVEVHHVKFGDKEAYITYKRSYSNRGNNGGGRSPTRAGSRNSNFRGREN-QARDNSRFQ 455 Query: 62 NGNRTGCAEGQ 30 N NR +GQ Sbjct: 456 NENRADHNKGQ 466