BLASTX nr result
ID: Forsythia22_contig00062432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00062432 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02363.1| unnamed protein product [Coffea canephora] 62 1e-07 ref|XP_011099068.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 >emb|CDP02363.1| unnamed protein product [Coffea canephora] Length = 881 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -3 Query: 184 CLTSRFLFLPKPPFHNFTSVSIFKISTDTQATQAPSIYRKTFSHIFQECSSQRALEPGKQ 5 C T RFL KP F ++ ++ F IST + AP+ Y KTFSHIFQECS +RAL+PG Q Sbjct: 6 CRTRRFLVPTKPSFSSYLALYTFPISTVSAV--APANYWKTFSHIFQECSKERALDPGMQ 63 Query: 4 A 2 + Sbjct: 64 S 64 >ref|XP_011099068.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02330 [Sesamum indicum] Length = 888 Score = 57.0 bits (136), Expect = 5e-06 Identities = 34/68 (50%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = -3 Query: 196 MASRCLTSRFLFLPKPPFHNFTS---VSIFKISTDTQATQAPSIYRKTFSHIFQECSSQR 26 MA+ LT F P F NF V IST Q Q+ Y+KTFSHIFQECS+ R Sbjct: 1 MAAYFLTRLFDLQLHPRFPNFLPNLPVCFCSISTFAQRNQSSPFYKKTFSHIFQECSNGR 60 Query: 25 ALEPGKQA 2 AL PG+QA Sbjct: 61 ALGPGRQA 68