BLASTX nr result
ID: Forsythia22_contig00062169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00062169 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093071.1| PREDICTED: BAG family molecular chaperone re... 62 2e-07 >ref|XP_011093071.1| PREDICTED: BAG family molecular chaperone regulator 6 [Sesamum indicum] Length = 1266 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = -2 Query: 134 MDPAYGCMQSYPYQKGQVHYRPYYYPNTESVLTPMYADPAQFP 6 MDP Y MQSYPYQK Q+HY P YYP E+V PMY +P Q P Sbjct: 1 MDPIYKNMQSYPYQKDQLHYGPGYYPGNEAVPMPMYVNPVQPP 43