BLASTX nr result
ID: Forsythia22_contig00062157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00062157 (257 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827419.1| PREDICTED: reticuline oxidase-like protein [... 60 9e-16 ref|XP_006360316.1| PREDICTED: reticuline oxidase-like protein-l... 62 3e-13 ref|XP_010648252.1| PREDICTED: reticuline oxidase-like protein [... 65 5e-13 ref|XP_003631731.2| PREDICTED: reticuline oxidase-like protein [... 65 5e-13 ref|XP_002268606.1| PREDICTED: reticuline oxidase-like protein [... 60 2e-12 emb|CAN81650.1| hypothetical protein VITISV_003752 [Vitis vinifera] 60 4e-12 ref|XP_004231557.1| PREDICTED: reticuline oxidase-like protein [... 60 5e-12 ref|XP_002270139.2| PREDICTED: reticuline oxidase-like protein [... 63 9e-12 ref|XP_009795337.1| PREDICTED: reticuline oxidase-like protein [... 59 2e-11 ref|XP_009630062.1| PREDICTED: reticuline oxidase-like protein [... 58 2e-11 ref|XP_011096699.1| PREDICTED: reticuline oxidase-like protein [... 60 3e-11 ref|XP_010648256.1| PREDICTED: reticuline oxidase-like protein [... 57 7e-11 ref|XP_011085610.1| PREDICTED: reticuline oxidase-like protein [... 61 9e-11 ref|XP_009795338.1| PREDICTED: reticuline oxidase-like protein [... 60 2e-10 ref|XP_002523157.1| Reticuline oxidase precursor, putative [Rici... 50 2e-10 gb|KJB29873.1| hypothetical protein B456_005G121800, partial [Go... 54 3e-10 ref|XP_012453076.1| PREDICTED: reticuline oxidase-like protein [... 54 4e-10 ref|XP_002523158.1| Reticuline oxidase precursor, putative [Rici... 50 6e-10 ref|XP_011085609.1| PREDICTED: reticuline oxidase-like protein [... 54 7e-10 ref|XP_012454953.1| PREDICTED: reticuline oxidase-like protein [... 52 7e-10 >ref|XP_012827419.1| PREDICTED: reticuline oxidase-like protein [Erythranthe guttatus] gi|604299167|gb|EYU19102.1| hypothetical protein MIMGU_mgv1a022353mg [Erythranthe guttata] Length = 549 Score = 60.1 bits (144), Expect(2) = 9e-16 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 +R TFI +LG++ L+SVMK+ FPEL LT+QDC+E SWIQS+L Sbjct: 321 VRVTFIAQYLGNANELLSVMKSQFPELGLTQQDCIETSWIQSVL 364 Score = 49.7 bits (117), Expect(2) = 9e-16 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 150 ANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 AN++NG E +LLDRK S NFFK K +YLKT IPK Sbjct: 367 ANYNNGTSEKVLLDRKSDSENFFKRKSDYLKTPIPK 402 >ref|XP_006360316.1| PREDICTED: reticuline oxidase-like protein-like [Solanum tuberosum] Length = 544 Score = 62.0 bits (149), Expect(2) = 3e-13 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +1 Query: 1 RRSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + + +R TFI LFLGDS L+S++ FP L LTKQDC+EMSWI S+L Sbjct: 306 KSTKSIRATFIALFLGDSSRLMSLISKEFPLLGLTKQDCLEMSWIDSVL 354 Score = 39.3 bits (90), Expect(2) = 3e-13 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 +DS+ ANFD+ LL+RKG N+ K K +Y++T IPK Sbjct: 350 IDSVLHWANFDSTTKPEALLNRKGDPLNYLKRKSDYVQTSIPK 392 >ref|XP_010648252.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera] Length = 535 Score = 65.5 bits (158), Expect(2) = 5e-13 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 +R TFI LFLGDS L+SVM FPEL L K+DCMEMSWI+S+L Sbjct: 307 VRVTFISLFLGDSTRLISVMNKDFPELGLKKEDCMEMSWIESVL 350 Score = 35.0 bits (79), Expect(2) = 5e-13 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDNG ++LL+R S NF K K +Y++ I + Sbjct: 346 IESVLYWANFDNGTSVDVLLNRTSDSVNFLKRKSDYVQKPISR 388 >ref|XP_003631731.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera] Length = 535 Score = 65.5 bits (158), Expect(2) = 5e-13 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 +R TFI LFLGDS L+SVM FPEL L K+DCMEMSWI+S+L Sbjct: 307 VRVTFISLFLGDSTRLISVMNKDFPELGLKKEDCMEMSWIESVL 350 Score = 35.0 bits (79), Expect(2) = 5e-13 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDNG ++LL+R S NF K K +Y++ I + Sbjct: 346 IESVLYWANFDNGTSVDVLLNRTSDSVNFLKRKSDYVQKPISR 388 >ref|XP_002268606.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera] Length = 532 Score = 60.1 bits (144), Expect(2) = 2e-12 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 ++ +R +F+ LFLGD+ L+SVM FP L L K+DCMEMSWI+S+L Sbjct: 303 KNRTIRASFVSLFLGDAARLLSVMDKDFPALGLKKEDCMEMSWIESVL 350 Score = 38.1 bits (87), Expect(2) = 2e-12 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDNG + LL+R S NF K K +Y++T I K Sbjct: 346 IESVLYWANFDNGTSPDALLNRTSDSVNFLKRKSDYVQTPISK 388 >emb|CAN81650.1| hypothetical protein VITISV_003752 [Vitis vinifera] Length = 532 Score = 60.1 bits (144), Expect(2) = 4e-12 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 ++ +R +F+ LFLGD+ L+SVM FP L L K+DCMEMSWI+S+L Sbjct: 303 KNRTIRASFVSLFLGDAARLLSVMDKDFPALGLKKEDCMEMSWIESVL 350 Score = 37.4 bits (85), Expect(2) = 4e-12 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDNG + LL+R S NF K K +Y++T I K Sbjct: 346 IESVLYWANFDNGTSADALLNRISDSVNFLKRKSDYVQTPISK 388 >ref|XP_004231557.1| PREDICTED: reticuline oxidase-like protein [Solanum lycopersicum] Length = 541 Score = 59.7 bits (143), Expect(2) = 5e-12 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +1 Query: 1 RRSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + S +R TF+ LFLGDS L+S++ FP L L KQDC+EMSWI S+L Sbjct: 302 KSSKSIRATFVALFLGDSTRLMSLISKQFPLLGLKKQDCVEMSWIDSVL 350 Score = 37.4 bits (85), Expect(2) = 5e-12 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 +DS+ ANFDN LL+RKG K K +Y++T IPK Sbjct: 346 IDSVLQWANFDNTTKPEALLNRKGDPLTHLKRKSDYVQTPIPK 388 >ref|XP_002270139.2| PREDICTED: reticuline oxidase-like protein [Vitis vinifera] Length = 539 Score = 63.2 bits (152), Expect(2) = 9e-12 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +1 Query: 7 SSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 S +R TFI LFLGD+ L+SVM FPEL L K+DC EMSWI+S+L Sbjct: 303 SKTVRVTFISLFLGDATRLISVMNKDFPELGLKKEDCKEMSWIESVL 349 Score = 33.1 bits (74), Expect(2) = 9e-12 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDN N+LL+R S FFK+K +Y++ + K Sbjct: 345 IESVLYWANFDNRTSVNVLLNRTLESVKFFKAKSDYMQKPMSK 387 >ref|XP_009795337.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris] Length = 559 Score = 59.3 bits (142), Expect(2) = 2e-11 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + +R TFI LFLGDS L+S++ P L LTKQDC EMSWI S+L Sbjct: 320 QQKSIRVTFIALFLGDSSRLISLVSNELPALGLTKQDCFEMSWIDSVL 367 Score = 35.4 bits (80), Expect(2) = 2e-11 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 +DS+ ANFDN LL+R G NF K K +Y++ IP+ Sbjct: 363 IDSVLQWANFDNTTKPIALLNRTGDPLNFLKRKSDYVQEPIPR 405 >ref|XP_009630062.1| PREDICTED: reticuline oxidase-like protein [Nicotiana tomentosiformis] Length = 559 Score = 58.2 bits (139), Expect(2) = 2e-11 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + +R TFI LFLGDS L+S++ P L LTKQDC EM+WI S+L Sbjct: 320 QQKSIRVTFIALFLGDSSRLISLVSNELPALGLTKQDCFEMNWIDSVL 367 Score = 36.6 bits (83), Expect(2) = 2e-11 Identities = 19/45 (42%), Positives = 26/45 (57%) Frame = +3 Query: 123 NELDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 N +DS+ ANFDN LL+R G NF K K +Y++ IP+ Sbjct: 361 NWIDSVLQWANFDNTTKPIALLNRTGDPLNFLKRKSDYVQEPIPR 405 >ref|XP_011096699.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum] Length = 532 Score = 59.7 bits (143), Expect(2) = 3e-11 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + +R TFIGLFLGDS L+S+ + FP+L L K DC EMSWI S+L Sbjct: 293 KKRSVRATFIGLFLGDSTRLLSITGSEFPKLELKKSDCHEMSWINSVL 340 Score = 34.7 bits (78), Expect(2) = 3e-11 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +3 Query: 153 NFDNGALENLLLDRKGGSPNFFKSKLEYLKTLI 251 NFDN N+LL R S NF K K +Y+KT I Sbjct: 344 NFDNTTSPNVLLSRNPDSVNFLKRKSDYVKTPI 376 >ref|XP_010648256.1| PREDICTED: reticuline oxidase-like protein [Vitis vinifera] Length = 410 Score = 57.4 bits (137), Expect(2) = 7e-11 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = +1 Query: 1 RRSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + + ++ +F LFLGD+ L+SVM FPEL L K+DC+EM+WI+S+L Sbjct: 177 KSTKTVKVSFTSLFLGDATRLISVMNKDFPELGLKKEDCIEMNWIESVL 225 Score = 35.8 bits (81), Expect(2) = 7e-11 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 123 NELDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 N ++S+ ANFDNG N+LL+R S F K K +Y++ I K Sbjct: 219 NWIESVLYWANFDNGTSVNVLLNRTPESVKFLKRKSDYVQKPISK 263 >ref|XP_011085610.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum] Length = 532 Score = 60.8 bits (146), Expect(2) = 9e-11 Identities = 25/49 (51%), Positives = 39/49 (79%) Frame = +1 Query: 1 RRSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + + +R +FI LFLGD+ LV+++K+GFPEL L K++C E+SWI+S+L Sbjct: 298 KNKTSVRASFIALFLGDANKLVALIKSGFPELGLKKEECKEISWIRSVL 346 Score = 32.0 bits (71), Expect(2) = 9e-11 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 Query: 150 ANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 A++ G E LL RK P+ K K +Y+KT IPK Sbjct: 349 ADYPEGTPETALLVRKSAFPSASKMKSDYVKTPIPK 384 >ref|XP_009795338.1| PREDICTED: reticuline oxidase-like protein [Nicotiana sylvestris] Length = 572 Score = 60.1 bits (144), Expect(2) = 2e-10 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 1 RRSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 ++ +R F+GLFLGDS L++++ FP LRL KQDC EMSWI S+L Sbjct: 306 QQKKTIRAAFLGLFLGDSSRLMTLVSKEFPALRLQKQDCYEMSWIDSVL 354 Score = 32.0 bits (71), Expect(2) = 2e-10 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 +DS+ A+FDN +LL+R G N K K +Y++ IP+ Sbjct: 350 IDSVLRWASFDNTTKPIVLLNRTGDLSNLLKRKSDYVQEPIPR 392 >ref|XP_002523157.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537564|gb|EEF39188.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 539 Score = 50.4 bits (119), Expect(2) = 2e-10 Identities = 21/48 (43%), Positives = 35/48 (72%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + LR + + L+LG++ +LV+++ FPEL L K++C EM+WIQS+L Sbjct: 305 KQQTLRVSIVSLYLGNADSLVALLGKEFPELGLKKENCTEMNWIQSVL 352 Score = 41.2 bits (95), Expect(2) = 2e-10 Identities = 21/45 (46%), Positives = 28/45 (62%) Frame = +3 Query: 123 NELDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 N + S+ ANFDNG ++LLDR S NF K K +Y++ IPK Sbjct: 346 NWIQSVLWWANFDNGTSPDVLLDRNVDSANFLKRKSDYVQKPIPK 390 >gb|KJB29873.1| hypothetical protein B456_005G121800, partial [Gossypium raimondii] Length = 468 Score = 54.3 bits (129), Expect(2) = 3e-10 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = +1 Query: 25 TFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQS 141 +F+GLFLG++ LV ++ FPEL LTK+DC EMSW++S Sbjct: 285 SFMGLFLGEADKLVPLVNQSFPELNLTKEDCKEMSWLES 323 Score = 36.6 bits (83), Expect(2) = 3e-10 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +3 Query: 150 ANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIP 254 A F G +LL+R G+PN FK K +Y+KT+IP Sbjct: 328 AGFPVGTPVQVLLNRTQGAPNIFKVKSDYVKTVIP 362 >ref|XP_012453076.1| PREDICTED: reticuline oxidase-like protein [Gossypium raimondii] gi|763802196|gb|KJB69134.1| hypothetical protein B456_011G007300 [Gossypium raimondii] Length = 530 Score = 54.3 bits (129), Expect(2) = 4e-10 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 +R +FIG FLG + L+ +M FPEL LT+ DC+EMSW++S L Sbjct: 300 VRVSFIGHFLGQADGLLRLMNVSFPELGLTRNDCLEMSWVESTL 343 Score = 36.2 bits (82), Expect(2) = 4e-10 Identities = 19/36 (52%), Positives = 23/36 (63%) Frame = +3 Query: 150 ANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ANF NG ++LLDR + F KSK +Y K LIPK Sbjct: 346 ANFPNGTSIDVLLDRVQENRVFSKSKSDYYKALIPK 381 >ref|XP_002523158.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537565|gb|EEF39189.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 539 Score = 50.4 bits (119), Expect(2) = 6e-10 Identities = 22/48 (45%), Positives = 34/48 (70%) Frame = +1 Query: 4 RSSDLRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 + LR T + L+LG + +LV+++ FPEL L K++C EM+WIQS+L Sbjct: 305 KQQTLRVTIMSLYLGKADSLVALLGKEFPELGLKKENCTEMNWIQSVL 352 Score = 39.7 bits (91), Expect(2) = 6e-10 Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = +3 Query: 123 NELDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 N + S+ ANFDNG ++LLDR S NF K K +Y++ IP+ Sbjct: 346 NWIQSVLWWANFDNGTSPDVLLDRHVDSANFLKRKSDYVQKPIPR 390 >ref|XP_011085609.1| PREDICTED: reticuline oxidase-like protein [Sesamum indicum] Length = 532 Score = 53.5 bits (127), Expect(2) = 7e-10 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 +R TFIGLFLG++ L+ + + FPEL L K DC EM WI S+L Sbjct: 298 VRATFIGLFLGNADRLLPITDSQFPELGLKKPDCTEMPWINSVL 341 Score = 36.2 bits (82), Expect(2) = 7e-10 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 ++S+ ANFDN ++LL+R S NF K K +Y+KT I K Sbjct: 337 INSVLYWANFDNTTSPSVLLNRTPDSVNFLKRKSDYVKTPIAK 379 >ref|XP_012454953.1| PREDICTED: reticuline oxidase-like protein [Gossypium raimondii] gi|763802203|gb|KJB69141.1| hypothetical protein B456_011G007700 [Gossypium raimondii] Length = 529 Score = 51.6 bits (122), Expect(2) = 7e-10 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = +1 Query: 16 LRKTFIGLFLGDSKNLVSVMKAGFPELRLTKQDCMEMSWIQSIL 147 ++ T +GL+LGD L++++ FPELRL K++C EM WI S+L Sbjct: 300 VKVTVMGLYLGDINGLLTLLNKDFPELRLNKENCTEMPWIDSVL 343 Score = 38.1 bits (87), Expect(2) = 7e-10 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +3 Query: 129 LDSIHPRANFDNGALENLLLDRKGGSPNFFKSKLEYLKTLIPK 257 +DS+ ANFD G N+LLDR F K K +Y++T IP+ Sbjct: 339 IDSVLWWANFDLGTPPNVLLDRNNTDTKFVKRKSDYVQTPIPR 381