BLASTX nr result
ID: Forsythia22_contig00061966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00061966 (367 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 67 5e-09 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -2 Query: 225 RSSFDLLSESPSARDSQITMAEFHLCSTTQSHNQAGLYHY 106 R +FD LSESPS RDS+ITMA+F LCST++SH+QAGLYHY Sbjct: 444 RRTFDPLSESPSTRDSRITMADFRLCSTSRSHSQAGLYHY 483