BLASTX nr result
ID: Forsythia22_contig00061632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00061632 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072176.1| PREDICTED: ferric reduction oxidase 8, mitoc... 80 4e-13 gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] 79 2e-12 ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prun... 79 2e-12 ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobr... 77 6e-12 ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitoc... 76 8e-12 ref|XP_010037521.1| PREDICTED: ferric reduction oxidase 8, mitoc... 76 1e-11 ref|XP_010037520.1| PREDICTED: ferric reduction oxidase 8, mitoc... 76 1e-11 ref|XP_002318065.1| ferric reductase-like transmembrane componen... 76 1e-11 ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitoc... 75 1e-11 ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitoc... 75 1e-11 ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus ... 75 1e-11 ref|XP_012079987.1| PREDICTED: ferric reduction oxidase 8, mitoc... 74 5e-11 ref|XP_002321628.1| ferric reductase-like transmembrane componen... 73 8e-11 gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like p... 71 2e-10 ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitoc... 71 3e-10 ref|XP_012567407.1| PREDICTED: ferric reduction oxidase 8, mitoc... 70 4e-10 ref|XP_011046222.1| PREDICTED: ferric reduction oxidase 8, mitoc... 70 4e-10 ref|XP_012446924.1| PREDICTED: ferric reduction oxidase 8, mitoc... 70 5e-10 ref|XP_012446923.1| PREDICTED: ferric reduction oxidase 8, mitoc... 70 5e-10 ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitoc... 70 5e-10 >ref|XP_011072176.1| PREDICTED: ferric reduction oxidase 8, mitochondrial, partial [Sesamum indicum] Length = 688 Score = 80.5 bits (197), Expect = 4e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW+SLW+LKPTE WTRKWK AE+K+TA+VFGYNGLDF VY Sbjct: 18 AGWLSLWVLKPTEFWTRKWKKAEEKSTASVFGYNGLDFVVY 58 >gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] Length = 722 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW+SLWLLKPT +WTRKWKG ED A T+FGY GLDFAVY Sbjct: 19 AGWVSLWLLKPTNLWTRKWKGVEDSARPTIFGYYGLDFAVY 59 >ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] gi|462406473|gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] Length = 687 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 A W+SLWLLKPT++WTRKWK AEDKA ATVFGY GL+FAVY Sbjct: 19 AAWVSLWLLKPTQLWTRKWKAAEDKARATVFGYYGLNFAVY 59 >ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] gi|508773566|gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] Length = 720 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = +1 Query: 193 SAGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 S GWISLWLLKPT WTRKWKGAE A TVFGY GLDFAVY Sbjct: 18 STGWISLWLLKPTNFWTRKWKGAEASAQDTVFGYYGLDFAVY 59 >ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine max] gi|734367772|gb|KHN18418.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja] Length = 711 Score = 76.3 bits (186), Expect = 8e-12 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW+SLWLLKPT++WTRKWK AED A T+FGY GL FAVY Sbjct: 21 AGWVSLWLLKPTQIWTRKWKQAEDSANDTIFGYYGLSFAVY 61 >ref|XP_010037521.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X2 [Eucalyptus grandis] Length = 716 Score = 75.9 bits (185), Expect = 1e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW++LW+LKPTE+WT+KWKGAE+ A TVFGY GL+FAVY Sbjct: 22 AGWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVY 62 >ref|XP_010037520.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X1 [Eucalyptus grandis] gi|629082785|gb|KCW49230.1| hypothetical protein EUGRSUZ_K02803 [Eucalyptus grandis] Length = 717 Score = 75.9 bits (185), Expect = 1e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW++LW+LKPTE+WT+KWKGAE+ A TVFGY GL+FAVY Sbjct: 22 AGWVALWILKPTEMWTKKWKGAEESAGGTVFGYYGLNFAVY 62 >ref|XP_002318065.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222858738|gb|EEE96285.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 743 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGWI+LWLLKPT +WTRKWKGAED A TVFGY GL+FAV+ Sbjct: 19 AGWIALWLLKPTNLWTRKWKGAEDSARHTVFGYYGLNFAVF 59 >ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X2 [Malus domestica] Length = 699 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 A WISLWLLKPT++WT+KWKGAED A TVFGY GL+FAVY Sbjct: 19 AAWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVY 59 >ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X1 [Malus domestica] Length = 706 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 A WISLWLLKPT++WT+KWKGAED A TVFGY GL+FAVY Sbjct: 19 AAWISLWLLKPTQLWTKKWKGAEDAARNTVFGYYGLNFAVY 59 >ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis] gi|223550445|gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis] Length = 726 Score = 75.5 bits (184), Expect = 1e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW+++W+LKPT +WTRKWK AED A +TVFGY GLDFAVY Sbjct: 19 AGWVAIWILKPTNLWTRKWKEAEDSARSTVFGYYGLDFAVY 59 >ref|XP_012079987.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Jatropha curcas] gi|643720772|gb|KDP31036.1| hypothetical protein JCGZ_11412 [Jatropha curcas] Length = 724 Score = 73.6 bits (179), Expect = 5e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGW+SLWLLKPT +WTRKWK AED A T+FGY GL+FA Y Sbjct: 19 AGWVSLWLLKPTNLWTRKWKEAEDSARPTIFGYYGLNFAAY 59 >ref|XP_002321628.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222868624|gb|EEF05755.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 722 Score = 72.8 bits (177), Expect = 8e-11 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGWI++W+ KPT +WTRKWKGAED ++ TVFGY GL+FAVY Sbjct: 19 AGWIAVWIQKPTNMWTRKWKGAEDSSSYTVFGYYGLNFAVY 59 >gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like protein [Gossypium arboreum] Length = 727 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +1 Query: 193 SAGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 S W+SLWLLKPT +WTRKWK AE A TVFGY GLDF VY Sbjct: 18 STAWLSLWLLKPTNLWTRKWKAAESSARNTVFGYYGLDFTVY 59 >ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus euphratica] gi|743908701|ref|XP_011047811.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus euphratica] Length = 733 Score = 70.9 bits (172), Expect = 3e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGWI+LWLLKPT++WT KWKGAED A VFGY GL+F V+ Sbjct: 28 AGWIALWLLKPTDLWTSKWKGAEDSARHAVFGYYGLNFGVF 68 >ref|XP_012567407.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cicer arietinum] Length = 707 Score = 70.5 bits (171), Expect = 4e-10 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 193 SAGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 SAGWISLWLLKPT+VWT WK AE A T+FGY GL+F VY Sbjct: 18 SAGWISLWLLKPTQVWTTTWKHAEQSANNTIFGYYGLNFVVY 59 >ref|XP_011046222.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Populus euphratica] Length = 722 Score = 70.5 bits (171), Expect = 4e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 199 GWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 GWI++W+ KPT +WTRKWKGAED + TVFGY GL+FAVY Sbjct: 20 GWITVWIQKPTNMWTRKWKGAEDSSRYTVFGYYGLNFAVY 59 >ref|XP_012446924.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X2 [Gossypium raimondii] gi|763792693|gb|KJB59689.1| hypothetical protein B456_009G267500 [Gossypium raimondii] Length = 726 Score = 70.1 bits (170), Expect = 5e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 193 SAGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 S W+SLWLLKPT +WT+KWK AE A TVFGY GLDF VY Sbjct: 18 STAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVY 59 >ref|XP_012446923.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X1 [Gossypium raimondii] gi|763792692|gb|KJB59688.1| hypothetical protein B456_009G267500 [Gossypium raimondii] Length = 727 Score = 70.1 bits (170), Expect = 5e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 193 SAGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 S W+SLWLLKPT +WT+KWK AE A TVFGY GLDF VY Sbjct: 18 STAWLSLWLLKPTNLWTKKWKAAESSARNTVFGYYGLDFTVY 59 >ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera] Length = 725 Score = 70.1 bits (170), Expect = 5e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 196 AGWISLWLLKPTEVWTRKWKGAEDKATATVFGYNGLDFAVY 318 AGWI+LW+LKPT++WT+KW AED A TVFGY GL+F VY Sbjct: 18 AGWITLWILKPTQLWTKKWHTAEDSARTTVFGYYGLNFVVY 58