BLASTX nr result
ID: Forsythia22_contig00059057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00059057 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossyp... 79 2e-12 ref|XP_012482057.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 79 2e-12 gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium h... 79 2e-12 ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|1705... 78 3e-12 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756... 77 3e-12 ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscy... 77 3e-12 ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 77 3e-12 ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsic... 77 3e-12 gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum an... 77 3e-12 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 77 3e-12 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 76 8e-12 ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209... 76 1e-11 pir||S46947 ribosomal protein L2 - evening primrose mitochondrio... 76 1e-11 ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 74 3e-11 emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] 74 3e-11 ref|XP_011000535.1| PREDICTED: 60S ribosomal protein L2, mitocho... 74 4e-11 ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|... 73 7e-11 ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 73 9e-11 gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella t... 71 2e-10 ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259... 71 3e-10 >ref|YP_009153938.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] gi|430728017|gb|AGA54174.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPF 149 VTYIIASHQLE GKMVMNCDWSKPSTSDLLRPAQNA P+ Sbjct: 296 VTYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNAHPY 334 >ref|XP_012482057.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial [Gossypium raimondii] Length = 334 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPF 149 VTYIIASHQLE GKMVMNCDWSKPSTSDLLRPAQNA P+ Sbjct: 296 VTYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNAHPY 334 >gb|AFO69218.1| ribosomal protein L2 (mitochondrion) [Gossypium hirsutum] Length = 334 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPF 149 VTYIIASHQLE GKMVMNCDWSKPSTSDLLRPAQNA P+ Sbjct: 296 VTYIIASHQLETGKMVMNCDWSKPSTSDLLRPAQNAHPY 334 >ref|YP_002608204.1| ribosomal protein L2 [Carica papaya] gi|170522383|gb|ACB20493.1| ribosomal protein L2 (mitochondrion) [Carica papaya] Length = 335 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPF 149 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQN P+ Sbjct: 297 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNDHPY 335 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756762100|gb|AJM70209.1| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 331 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 293 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] gi|756142178|gb|AJK91389.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] Length = 331 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 293 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial, partial [Solanum lycopersicum] Length = 323 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 285 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 320 >ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] gi|667752052|gb|AIG90138.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 332 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 294 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 329 >gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 329 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 291 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 326 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 293 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 328 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 76.3 bits (186), Expect = 8e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASH+LEAGKMVMNCDWSKPSTSDLLRPAQNA Sbjct: 297 VTYIIASHELEAGKMVMNCDWSKPSTSDLLRPAQNA 332 >ref|YP_002608368.1| ribosomal protein L2 [Vitis vinifera] gi|209954165|emb|CAQ77612.1| ribosomal protein L2 [Vitis vinifera] gi|239764759|gb|ACS15228.1| ribosomal protein L2 [Vitis vinifera] Length = 334 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPA+NA Sbjct: 296 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNA 331 >pir||S46947 ribosomal protein L2 - evening primrose mitochondrion (mitochondrion) [Oenothera villaricae] gi|516394|emb|CAA56451.1| 70s mitochondrial ribosomal protein L2 [Oenothera berteroana] Length = 332 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 VTYIIASHQLEAGKMVMNCDWSKPSTSD LRPAQNA Sbjct: 294 VTYIIASHQLEAGKMVMNCDWSKPSTSDFLRPAQNA 329 >ref|XP_006359087.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial-like [Solanum tuberosum] Length = 340 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 262 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 TYIIASHQLEAGKMVMNCDWSKPSTSDLL+PAQNA Sbjct: 303 TYIIASHQLEAGKMVMNCDWSKPSTSDLLQPAQNA 337 >emb|CAN61455.1| hypothetical protein VITISV_029794 [Vitis vinifera] Length = 336 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 262 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNA 158 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPA+NA Sbjct: 299 TYIIASHQLEAGKMVMNCDWSKPSTSDLLRPARNA 333 >ref|XP_011000535.1| PREDICTED: 60S ribosomal protein L2, mitochondrial [Populus euphratica] Length = 335 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPF 149 VTYIIASHQLEAGKM++NCDWSKPST DLLRPA+NA P+ Sbjct: 297 VTYIIASHQLEAGKMLINCDWSKPSTRDLLRPARNAHPY 335 >ref|YP_003587229.1| ribosomal protein L2 [Citrullus lanatus] gi|259156783|gb|ACV96645.1| ribosomal protein L2 [Citrullus lanatus] Length = 332 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQN 161 VTY+IA HQLEAGKMVMNCDWSKPSTSDLLRPAQN Sbjct: 294 VTYLIACHQLEAGKMVMNCDWSKPSTSDLLRPAQN 328 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 72.8 bits (177), Expect = 9e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPFI 146 VTYI+ASHQLEAGKMVMNCDWSKPSTS LRPAQNA ++ Sbjct: 332 VTYILASHQLEAGKMVMNCDWSKPSTSGFLRPAQNAHTYL 371 >gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella trichopoda] Length = 632 Score = 71.2 bits (173), Expect = 2e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQNACPFI 146 VTYI+ASHQLE GKMVMNCDWSKPSTS LRPAQNA ++ Sbjct: 413 VTYILASHQLEVGKMVMNCDWSKPSTSGFLRPAQNAHTYL 452 >ref|YP_003587363.1| ribosomal protein L2 [Cucurbita pepo] gi|259156826|gb|ACV96687.1| ribosomal protein L2 [Cucurbita pepo] Length = 332 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 265 VTYIIASHQLEAGKMVMNCDWSKPSTSDLLRPAQN 161 VTY+IASHQLEAGKMVMN DWSKPSTSDLLRPAQN Sbjct: 294 VTYLIASHQLEAGKMVMNYDWSKPSTSDLLRPAQN 328