BLASTX nr result
ID: Forsythia22_contig00057434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00057434 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ61101.1| hypothetical protein M437DRAFT_67485 [Aureobasidi... 129 7e-28 gb|KEQ94907.1| hypothetical protein AUEXF2481DRAFT_5173 [Aureoba... 125 1e-26 gb|KEQ79934.1| hypothetical protein M438DRAFT_349406 [Aureobasid... 125 1e-26 gb|KLU91107.1| 60S ribosomal protein L27-A [Magnaporthiopsis poa... 123 5e-26 gb|EKG17758.1| Ribosomal protein L27e [Macrophomina phaseolina MS6] 121 2e-25 ref|XP_009228409.1| 60S ribosomal protein L27-A [Gaeumannomyces ... 121 2e-25 dbj|GAM86657.1| hypothetical protein ANO11243_046730 [fungal sp.... 121 2e-25 ref|XP_002479924.1| 60S ribosomal protein L27 [Talaromyces stipi... 121 2e-25 gb|EZF11226.1| hypothetical protein H100_07669 [Trichophyton rub... 121 2e-25 gb|EZF11225.1| hypothetical protein H100_07669 [Trichophyton rub... 121 2e-25 gb|EGE00457.1| 60S ribosomal protein L27-A [Trichophyton tonsura... 121 2e-25 ref|XP_003177187.1| 60S ribosomal protein L27 [Microsporum gypse... 121 2e-25 ref|XP_002850593.1| 60S ribosomal protein L27 [Arthroderma otae ... 121 2e-25 gb|ELQ38677.1| 60S ribosomal protein L27-B [Magnaporthe oryzae Y... 120 3e-25 ref|XP_003709402.1| 60S ribosomal protein L27-A [Magnaporthe ory... 120 3e-25 gb|KKY24219.1| putative 60s ribosomal protein l27 [Diplodia seri... 120 5e-25 gb|KJK63702.1| Ribosomal L27e protein family protein [Aspergillu... 120 5e-25 ref|XP_002381915.1| 60S ribosomal protein L27 [Aspergillus flavu... 120 5e-25 dbj|BAE56933.1| unnamed protein product [Aspergillus oryzae RIB4... 120 5e-25 emb|CEJ54452.1| Putative 60S ribosomal protein L27 [Penicillium ... 119 6e-25 >gb|KEQ61101.1| hypothetical protein M437DRAFT_67485 [Aureobasidium melanogenum CBS 110374] gi|662517195|gb|KEQ74757.1| hypothetical protein M436DRAFT_62204 [Aureobasidium namibiae CBS 147.97] Length = 135 Score = 129 bits (324), Expect = 7e-28 Identities = 61/61 (100%), Positives = 61/61 (100%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR Sbjct: 75 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|KEQ94907.1| hypothetical protein AUEXF2481DRAFT_5173 [Aureobasidium subglaciale EXF-2481] Length = 147 Score = 125 bits (313), Expect = 1e-26 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL 116 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL Sbjct: 75 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL 133 >gb|KEQ79934.1| hypothetical protein M438DRAFT_349406 [Aureobasidium pullulans EXF-150] Length = 147 Score = 125 bits (313), Expect = 1e-26 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL 116 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL Sbjct: 75 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPL 133 >gb|KLU91107.1| 60S ribosomal protein L27-A [Magnaporthiopsis poae ATCC 64411] Length = 135 Score = 123 bits (308), Expect = 5e-26 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQREDAKKN+KK LEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|EKG17758.1| Ribosomal protein L27e [Macrophomina phaseolina MS6] Length = 135 Score = 121 bits (304), Expect = 2e-25 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG VTNDTFKEVSQRE+AKK +KKALEERYQSGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGVVTNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >ref|XP_009228409.1| 60S ribosomal protein L27-A [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402074566|gb|EJT70075.1| 60S ribosomal protein L27-A [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 135 Score = 121 bits (304), Expect = 2e-25 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG VTNDTFKEVSQREDAKKN+KK LEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGTVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >dbj|GAM86657.1| hypothetical protein ANO11243_046730 [fungal sp. No.11243] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 58/61 (95%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNHIMPTRYTLELEGLKG VTNDTFKEVSQREDAKK +KKALEERY SGKN+WFFTPLR Sbjct: 75 NYNHIMPTRYTLELEGLKGVVTNDTFKEVSQREDAKKTVKKALEERYVSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >ref|XP_002479924.1| 60S ribosomal protein L27 [Talaromyces stipitatus ATCC 10500] gi|218720071|gb|EED19490.1| 60S ribosomal protein L27e [Talaromyces stipitatus ATCC 10500] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG ++NDTFKEVSQREDAKK +KKALEERYQSGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGVISNDTFKEVSQREDAKKTVKKALEERYQSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|EZF11226.1| hypothetical protein H100_07669 [Trichophyton rubrum MR850] gi|607900380|gb|EZF38091.1| hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081] gi|607912505|gb|EZF48730.1| hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86] gi|607924644|gb|EZF59428.1| hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86] gi|607936489|gb|EZF69968.1| hypothetical protein H105_07660 [Trichophyton soudanense CBS 452.61] gi|607948529|gb|EZF80662.1| hypothetical protein H110_07654 [Trichophyton rubrum MR1448] gi|607960648|gb|EZF91310.1| hypothetical protein H113_07715 [Trichophyton rubrum MR1459] gi|607972943|gb|EZG02247.1| hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88] gi|607984643|gb|EZG12891.1| hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88] gi|633054604|gb|KDB29827.1| hypothetical protein H112_07644 [Trichophyton rubrum D6] gi|674804717|gb|KFL60147.1| hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892] Length = 132 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQRE+AKK IKKALEERY SGKN+WFFTPLR Sbjct: 72 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLR 131 Query: 112 F 110 F Sbjct: 132 F 132 >gb|EZF11225.1| hypothetical protein H100_07669 [Trichophyton rubrum MR850] gi|607900379|gb|EZF38090.1| hypothetical protein H102_07634 [Trichophyton rubrum CBS 100081] gi|607912504|gb|EZF48729.1| hypothetical protein H103_07657 [Trichophyton rubrum CBS 288.86] gi|607924643|gb|EZF59427.1| hypothetical protein H104_07605 [Trichophyton rubrum CBS 289.86] gi|607936488|gb|EZF69967.1| hypothetical protein H105_07660 [Trichophyton soudanense CBS 452.61] gi|607948528|gb|EZF80661.1| hypothetical protein H110_07654 [Trichophyton rubrum MR1448] gi|607960647|gb|EZF91309.1| hypothetical protein H113_07715 [Trichophyton rubrum MR1459] gi|607972942|gb|EZG02246.1| hypothetical protein H106_07492 [Trichophyton rubrum CBS 735.88] gi|607984642|gb|EZG12890.1| hypothetical protein H107_07791 [Trichophyton rubrum CBS 202.88] gi|633054603|gb|KDB29826.1| hypothetical protein H112_07644 [Trichophyton rubrum D6] gi|674804716|gb|KFL60146.1| hypothetical protein TERG_00242 [Trichophyton rubrum CBS 118892] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQRE+AKK IKKALEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|EGE00457.1| 60S ribosomal protein L27-A [Trichophyton tonsurans CBS 112818] gi|607895589|gb|EZF34255.1| hypothetical protein H101_02193 [Trichophyton interdigitale H6] gi|633045996|gb|KDB22715.1| hypothetical protein H109_05381 [Trichophyton interdigitale MR816] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQRE+AKK IKKALEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >ref|XP_003177187.1| 60S ribosomal protein L27 [Microsporum gypseum CBS 118893] gi|311339033|gb|EFQ98235.1| 60S ribosomal protein L27-A [Microsporum gypseum CBS 118893] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQRE+AKK IKKALEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >ref|XP_002850593.1| 60S ribosomal protein L27 [Arthroderma otae CBS 113480] gi|238838147|gb|EEQ27809.1| 60S ribosomal protein L27-A [Arthroderma otae CBS 113480] Length = 135 Score = 121 bits (303), Expect = 2e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAVTNDTFKEVSQRE+AKK IKKALEERY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVTNDTFKEVSQREEAKKTIKKALEERYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|ELQ38677.1| 60S ribosomal protein L27-B [Magnaporthe oryzae Y34] gi|440482866|gb|ELQ63318.1| 60S ribosomal protein L27-B [Magnaporthe oryzae P131] Length = 149 Score = 120 bits (302), Expect = 3e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG+VTNDTFKEVSQREDAKKN+KK LEERY SGKN+WFFTPL+ Sbjct: 89 NYNHLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNRWFFTPLK 148 Query: 112 F 110 F Sbjct: 149 F 149 >ref|XP_003709402.1| 60S ribosomal protein L27-A [Magnaporthe oryzae 70-15] gi|351648931|gb|EHA56790.1| 60S ribosomal protein L27-A [Magnaporthe oryzae 70-15] Length = 135 Score = 120 bits (302), Expect = 3e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG+VTNDTFKEVSQREDAKKN+KK LEERY SGKN+WFFTPL+ Sbjct: 75 NYNHLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNRWFFTPLK 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|KKY24219.1| putative 60s ribosomal protein l27 [Diplodia seriata] Length = 135 Score = 120 bits (300), Expect = 5e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG V+NDTFKEVSQRE+AKK +KKALEERYQSGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGVVSNDTFKEVSQREEAKKTVKKALEERYQSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >gb|KJK63702.1| Ribosomal L27e protein family protein [Aspergillus parasiticus SU-1] Length = 132 Score = 120 bits (300), Expect = 5e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG+VTNDTFKEVSQREDAKK +KKALE+RY SGKN+WFFTPLR Sbjct: 72 NYNHLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLR 131 Query: 112 F 110 F Sbjct: 132 F 132 >ref|XP_002381915.1| 60S ribosomal protein L27 [Aspergillus flavus NRRL3357] gi|317142478|ref|XP_001818935.2| 60S ribosomal protein L27 [Aspergillus oryzae RIB40] gi|220692152|gb|EED48499.1| 60S ribosomal protein L27e [Aspergillus flavus NRRL3357] Length = 135 Score = 120 bits (300), Expect = 5e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG+VTNDTFKEVSQREDAKK +KKALE+RY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135 >dbj|BAE56933.1| unnamed protein product [Aspergillus oryzae RIB40] gi|768703476|gb|KJJ30437.1| Ribosomal L27e protein family protein [Aspergillus flavus AF70] Length = 132 Score = 120 bits (300), Expect = 5e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKG+VTNDTFKEVSQREDAKK +KKALE+RY SGKN+WFFTPLR Sbjct: 72 NYNHLMPTRYTLELEGLKGSVTNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLR 131 Query: 112 F 110 F Sbjct: 132 F 132 >emb|CEJ54452.1| Putative 60S ribosomal protein L27 [Penicillium brasilianum] Length = 135 Score = 119 bits (299), Expect = 6e-25 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -1 Query: 292 NYNHIMPTRYTLELEGLKGAVTNDTFKEVSQREDAKKNIKKALEERYQSGKNKWFFTPLR 113 NYNH+MPTRYTLELEGLKGAV+NDTFKEVSQREDAKK +KKALE+RY SGKN+WFFTPLR Sbjct: 75 NYNHLMPTRYTLELEGLKGAVSNDTFKEVSQREDAKKTVKKALEDRYTSGKNRWFFTPLR 134 Query: 112 F 110 F Sbjct: 135 F 135