BLASTX nr result
ID: Forsythia22_contig00057244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00057244 (460 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 55 1e-06 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +1 Query: 307 ILTKIISAKKVLDKRKKSTPVPIYKNK*NIQNSANDRGTRLMSQTMKL 450 + +I+ KK+LD+ ++ST +PIYKNK +IQ+ AN RG +LMS TMKL Sbjct: 59 LFNEIMKTKKMLDEWRRSTLIPIYKNKGDIQHCANYRGIKLMSHTMKL 106 Score = 23.5 bits (49), Expect(2) = 1e-06 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +3 Query: 153 PDDIPVEV*KSCRS-*VSWLTK 215 PD+IP+EV KS + WLTK Sbjct: 37 PDNIPIEVWKSLGDRGIVWLTK 58