BLASTX nr result
ID: Forsythia22_contig00057226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00057226 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp.... 52 4e-06 >ref|XP_002888381.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297334222|gb|EFH64640.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 50 Score = 52.4 bits (124), Expect(2) = 4e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +3 Query: 192 GSDHRKESLQENQPIFCIGLTRRLEQRHIWL 284 G DHRK+SL+ NQPI C+GLT+ LEQRHIWL Sbjct: 20 GYDHRKDSLKVNQPIPCMGLTQWLEQRHIWL 50 Score = 25.0 bits (53), Expect(2) = 4e-06 Identities = 11/18 (61%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = +2 Query: 137 LFH-LLYWILRSLLIYNT 187 +FH L+YWILRS LI+ + Sbjct: 1 MFHPLIYWILRSPLIHGS 18