BLASTX nr result
ID: Forsythia22_contig00057180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00057180 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73392.1| hypothetical protein VITISV_022526 [Vitis vinifera] 70 4e-10 emb|CAN83734.1| hypothetical protein VITISV_024044 [Vitis vinifera] 70 7e-10 emb|CAN67506.1| hypothetical protein VITISV_026948 [Vitis vinifera] 70 7e-10 emb|CAN63210.1| hypothetical protein VITISV_021170 [Vitis vinifera] 69 9e-10 emb|CAN79949.1| hypothetical protein VITISV_044422 [Vitis vinifera] 68 2e-09 emb|CAN80183.1| hypothetical protein VITISV_015370 [Vitis vinifera] 68 2e-09 emb|CAN68175.1| hypothetical protein VITISV_010332 [Vitis vinifera] 68 2e-09 emb|CAN62921.1| hypothetical protein VITISV_032126 [Vitis vinifera] 68 2e-09 emb|CAN78025.1| hypothetical protein VITISV_031335 [Vitis vinifera] 68 2e-09 emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] 68 2e-09 emb|CAN67418.1| hypothetical protein VITISV_005919 [Vitis vinifera] 68 2e-09 emb|CAN66375.1| hypothetical protein VITISV_037549 [Vitis vinifera] 68 2e-09 emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera] 68 2e-09 emb|CAN83721.1| hypothetical protein VITISV_003961 [Vitis vinifera] 68 3e-09 emb|CAN74290.1| hypothetical protein VITISV_036414 [Vitis vinifera] 68 3e-09 emb|CAN60445.1| hypothetical protein VITISV_032468 [Vitis vinifera] 67 4e-09 emb|CAN64090.1| hypothetical protein VITISV_002951 [Vitis vinifera] 67 6e-09 emb|CAN61660.1| hypothetical protein VITISV_000260 [Vitis vinifera] 67 6e-09 emb|CAN79930.1| hypothetical protein VITISV_007488 [Vitis vinifera] 66 8e-09 emb|CAN82537.1| hypothetical protein VITISV_013040 [Vitis vinifera] 66 8e-09 >emb|CAN73392.1| hypothetical protein VITISV_022526 [Vitis vinifera] Length = 1020 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ DL HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 946 KAACDIAHNPVQHDLTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 993 >emb|CAN83734.1| hypothetical protein VITISV_024044 [Vitis vinifera] Length = 907 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +2 Query: 104 ATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 A DI HNPVQ DL HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 834 ACDIAHNPVQHDLTKHVEVDRFFIKEKLDDKIVELPKIRSKDQLAD 879 >emb|CAN67506.1| hypothetical protein VITISV_026948 [Vitis vinifera] Length = 1063 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HVKVDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 989 KAACDITHNPVQHDRTKHVKVDRFFIKEKLDDKIVELPKIRSEDQLAD 1036 >emb|CAN63210.1| hypothetical protein VITISV_021170 [Vitis vinifera] Length = 512 Score = 69.3 bits (168), Expect = 9e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +2 Query: 104 ATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 A DI HNP+Q D HV+VDRFFI KKLD+KIVKLPKIRS D LAD Sbjct: 455 ACDIAHNPLQHDRTKHVEVDRFFIKKKLDDKIVKLPKIRSEDQLAD 500 >emb|CAN79949.1| hypothetical protein VITISV_044422 [Vitis vinifera] Length = 1176 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 1102 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1149 >emb|CAN80183.1| hypothetical protein VITISV_015370 [Vitis vinifera] Length = 538 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 37/48 (77%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HVKVDRFFI +KLD+KIV+LPKIRS D L D Sbjct: 464 KAACDIAHNPVQHDRTKHVKVDRFFIKEKLDDKIVELPKIRSEDQLVD 511 >emb|CAN68175.1| hypothetical protein VITISV_010332 [Vitis vinifera] Length = 660 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 586 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 633 >emb|CAN62921.1| hypothetical protein VITISV_032126 [Vitis vinifera] Length = 1085 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 1011 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1058 >emb|CAN78025.1| hypothetical protein VITISV_031335 [Vitis vinifera] Length = 1861 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 903 KAACDIAHNPVQYDCTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 950 >emb|CAN66607.1| hypothetical protein VITISV_017554 [Vitis vinifera] Length = 2822 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 2346 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 2393 >emb|CAN67418.1| hypothetical protein VITISV_005919 [Vitis vinifera] Length = 960 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 886 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 933 >emb|CAN66375.1| hypothetical protein VITISV_037549 [Vitis vinifera] Length = 1347 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 939 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 986 >emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera] Length = 1030 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 956 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1003 >emb|CAN83721.1| hypothetical protein VITISV_003961 [Vitis vinifera] Length = 1101 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 104 ATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 1029 ACDIAHNPVQHDCTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1074 >emb|CAN74290.1| hypothetical protein VITISV_036414 [Vitis vinifera] Length = 584 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNP+Q D HVKVDRFFI +KLD+KIV+LPKI+S D LAD Sbjct: 510 KAACDIAHNPIQHDRTKHVKVDRFFIKEKLDDKIVELPKIQSEDQLAD 557 >emb|CAN60445.1| hypothetical protein VITISV_032468 [Vitis vinifera] Length = 1121 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 104 ATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 1049 ACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1094 >emb|CAN64090.1| hypothetical protein VITISV_002951 [Vitis vinifera] Length = 1336 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D L D Sbjct: 1241 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLVD 1288 >emb|CAN61660.1| hypothetical protein VITISV_000260 [Vitis vinifera] Length = 1087 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNPVQ D HV+VDRFFI +KLD+KIV+LPKIRS D L D Sbjct: 1013 KAACDIAHNPVQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLVD 1060 >emb|CAN79930.1| hypothetical protein VITISV_007488 [Vitis vinifera] Length = 1128 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + A DI HNP Q D HV+VDRFFI +KLD+KIV+LPKIRS D LAD Sbjct: 1054 KAACDIAHNPXQHDRTKHVEVDRFFIKEKLDDKIVELPKIRSEDQLAD 1101 >emb|CAN82537.1| hypothetical protein VITISV_013040 [Vitis vinifera] Length = 680 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +2 Query: 98 RGATDIVHNPVQQDLIMHVKVDRFFIMKKLDEKIVKLPKIRSYD*LAD 241 + DI HNPVQ D HVKVDRFFI +KLD+KIV+LPKIRS D L D Sbjct: 606 KATCDIAHNPVQHDRTKHVKVDRFFIKEKLDDKIVELPKIRSEDQLXD 653