BLASTX nr result
ID: Forsythia22_contig00056765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00056765 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083805.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 >ref|XP_011083805.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] gi|747073678|ref|XP_011083806.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] gi|747073680|ref|XP_011083807.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] gi|747073682|ref|XP_011083808.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] gi|747073684|ref|XP_011083809.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] gi|747073686|ref|XP_011083810.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16860 [Sesamum indicum] Length = 856 Score = 74.7 bits (182), Expect = 2e-11 Identities = 40/86 (46%), Positives = 53/86 (61%), Gaps = 5/86 (5%) Frame = -1 Query: 243 MLFSSSIPPKFRHLSITVHAL-----FFSSSAQHFESLTKAKLIHQQQVIRGAPLFADPN 79 ML ++ PPK+RH T+ L F SS+AQ SL + +LIHQ+ VI G +DP Sbjct: 1 MLLPTTFPPKYRHCCTTLRPLLLKLYFSSSAAQQCLSLAEPELIHQEHVIPGVTFPSDPE 60 Query: 78 ITTQVLSNYLTCDAHSEVLNLLRHLP 1 T QVLSNYL+ HS+ L+LLR +P Sbjct: 61 TTAQVLSNYLSSGRHSDTLSLLRRIP 86