BLASTX nr result
ID: Forsythia22_contig00056737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00056737 (278 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77047.1| hypothetical protein VITISV_035258 [Vitis vinifera] 54 2e-06 >emb|CAN77047.1| hypothetical protein VITISV_035258 [Vitis vinifera] Length = 384 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 1/69 (1%) Frame = -1 Query: 263 PVNT*QNIEA*TS*K-LHANSCDKLFADLLNLKQDSMSVVDYMQIFDYLKILSQTAEDQR 87 P++T Q ++A K + N DKL L+NL+Q++MSV +YMQ FD LK SQ ED + Sbjct: 166 PISTWQEMKAKLREKYMPTNYYDKLCDQLINLRQNNMSVAEYMQTFDELKTRSQIVEDPQ 225 Query: 86 HTIVCFRAG 60 T+ F+ G Sbjct: 226 QTLARFKVG 234 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 55 PEIKGELL*EPIDDVEHA 2 PEI+ ELL +P+ +EHA Sbjct: 237 PEIQRELLHQPLYSLEHA 254