BLASTX nr result
ID: Forsythia22_contig00056356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00056356 (339 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75995.1| hypothetical protein VITISV_005355 [Vitis vinifera] 56 8e-06 >emb|CAN75995.1| hypothetical protein VITISV_005355 [Vitis vinifera] Length = 566 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/64 (42%), Positives = 34/64 (53%), Gaps = 11/64 (17%) Frame = +2 Query: 95 QRKKPWCNHCRKPRHKTYTC*ELHEKPPY*KPRQTNRNRGYQASTDD-----------HS 241 Q +KPWC+HC+KP H TC +LH KPP K R +Q S +D HS Sbjct: 213 QGEKPWCDHCKKPWHTHETCWKLHGKPPNWKKENGGDGRVFQVSNEDQGNQPSQAHFFHS 272 Query: 242 SCSF 253 SC+F Sbjct: 273 SCAF 276