BLASTX nr result
ID: Forsythia22_contig00056224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00056224 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010087280.1| Aspartic proteinase-like protein 2 [Morus no... 67 4e-09 ref|XP_012830062.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 gb|KJB17990.1| hypothetical protein B456_003G027900 [Gossypium r... 67 4e-09 gb|KHG13615.1| hypothetical protein F383_03676 [Gossypium arboreum] 67 4e-09 gb|KHG13614.1| hypothetical protein F383_03676 [Gossypium arboreum] 67 4e-09 ref|XP_010327522.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 gb|EYU43424.1| hypothetical protein MIMGU_mgv1a0027551mg, partia... 67 4e-09 ref|XP_012837921.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 ref|XP_006339969.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 ref|XP_006339968.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 ref|XP_007047435.1| Aspartyl protease family protein [Theobroma ... 67 4e-09 ref|XP_004248841.1| PREDICTED: aspartic proteinase-like protein ... 67 4e-09 ref|XP_010070617.1| PREDICTED: aspartic proteinase CDR1-like [Eu... 67 6e-09 ref|XP_012489205.1| PREDICTED: aspartic proteinase-like protein ... 66 1e-08 gb|KJB40297.1| hypothetical protein B456_007G056000 [Gossypium r... 66 1e-08 gb|KHG08698.1| hypothetical protein F383_11875 [Gossypium arboreum] 66 1e-08 gb|KHG08697.1| hypothetical protein F383_11875 [Gossypium arboreum] 66 1e-08 ref|XP_012079339.1| PREDICTED: aspartic proteinase-like protein ... 65 1e-08 ref|XP_009603173.1| PREDICTED: aspartic proteinase-like protein ... 65 1e-08 ref|XP_009603172.1| PREDICTED: aspartic proteinase-like protein ... 65 1e-08 >ref|XP_010087280.1| Aspartic proteinase-like protein 2 [Morus notabilis] gi|587838000|gb|EXB28727.1| Aspartic proteinase-like protein 2 [Morus notabilis] Length = 647 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGS+VTYVPC+TCDQCGKHQ Sbjct: 105 PPQRFALIVDTGSSVTYVPCSTCDQCGKHQ 134 >ref|XP_012830062.1| PREDICTED: aspartic proteinase-like protein 2 [Erythranthe guttatus] Length = 652 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 98 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 127 >gb|KJB17990.1| hypothetical protein B456_003G027900 [Gossypium raimondii] Length = 571 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 104 PPQRFALIVDTGSTVTYVPCATCEQCGRHQ 133 >gb|KHG13615.1| hypothetical protein F383_03676 [Gossypium arboreum] Length = 601 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 58 PPQRFALIVDTGSTVTYVPCATCEQCGRHQ 87 >gb|KHG13614.1| hypothetical protein F383_03676 [Gossypium arboreum] Length = 608 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 58 PPQRFALIVDTGSTVTYVPCATCEQCGRHQ 87 >ref|XP_010327522.1| PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Solanum lycopersicum] Length = 586 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 93 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 122 >gb|EYU43424.1| hypothetical protein MIMGU_mgv1a0027551mg, partial [Erythranthe guttata] Length = 125 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 96 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 125 >ref|XP_012837921.1| PREDICTED: aspartic proteinase-like protein 2 [Erythranthe guttatus] gi|604332350|gb|EYU37054.1| hypothetical protein MIMGU_mgv1a003205mg [Erythranthe guttata] Length = 600 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 53 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 82 >ref|XP_006339969.1| PREDICTED: aspartic proteinase-like protein 2-like isoform X2 [Solanum tuberosum] Length = 583 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 96 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 125 >ref|XP_006339968.1| PREDICTED: aspartic proteinase-like protein 2-like isoform X1 [Solanum tuberosum] Length = 641 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 96 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 125 >ref|XP_007047435.1| Aspartyl protease family protein [Theobroma cacao] gi|508699696|gb|EOX91592.1| Aspartyl protease family protein [Theobroma cacao] Length = 647 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 102 PPQRFALIVDTGSTVTYVPCATCEQCGRHQ 131 >ref|XP_004248841.1| PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Solanum lycopersicum] Length = 638 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCGKHQ Sbjct: 93 PPQRFALIVDTGSTVTYVPCSTCEQCGKHQ 122 >ref|XP_010070617.1| PREDICTED: aspartic proteinase CDR1-like [Eucalyptus grandis] gi|629093520|gb|KCW59515.1| hypothetical protein EUGRSUZ_H02267 [Eucalyptus grandis] Length = 646 Score = 66.6 bits (161), Expect = 6e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQ+FALIVDTGSTVTYVPC+TCDQCG+HQ Sbjct: 105 PPQKFALIVDTGSTVTYVPCSTCDQCGRHQ 134 >ref|XP_012489205.1| PREDICTED: aspartic proteinase-like protein 2 [Gossypium raimondii] gi|763773175|gb|KJB40298.1| hypothetical protein B456_007G056000 [Gossypium raimondii] Length = 643 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQ+FALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 102 PPQQFALIVDTGSTVTYVPCATCEQCGRHQ 131 >gb|KJB40297.1| hypothetical protein B456_007G056000 [Gossypium raimondii] Length = 541 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQ+FALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 102 PPQQFALIVDTGSTVTYVPCATCEQCGRHQ 131 >gb|KHG08698.1| hypothetical protein F383_11875 [Gossypium arboreum] Length = 669 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQ+FALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 102 PPQQFALIVDTGSTVTYVPCATCEQCGRHQ 131 >gb|KHG08697.1| hypothetical protein F383_11875 [Gossypium arboreum] Length = 676 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQ+FALIVDTGSTVTYVPCATC+QCG+HQ Sbjct: 102 PPQQFALIVDTGSTVTYVPCATCEQCGRHQ 131 >ref|XP_012079339.1| PREDICTED: aspartic proteinase-like protein 2 [Jatropha curcas] Length = 642 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCG HQ Sbjct: 100 PPQRFALIVDTGSTVTYVPCSTCEQCGNHQ 129 >ref|XP_009603173.1| PREDICTED: aspartic proteinase-like protein 2 isoform X2 [Nicotiana tomentosiformis] Length = 637 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCG HQ Sbjct: 106 PPQRFALIVDTGSTVTYVPCSTCEQCGNHQ 135 >ref|XP_009603172.1| PREDICTED: aspartic proteinase-like protein 2 isoform X1 [Nicotiana tomentosiformis] Length = 648 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 287 PPQRFALIVDTGSTVTYVPCATCDQCGKHQ 198 PPQRFALIVDTGSTVTYVPC+TC+QCG HQ Sbjct: 106 PPQRFALIVDTGSTVTYVPCSTCEQCGNHQ 135