BLASTX nr result
ID: Forsythia22_contig00055990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055990 (267 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852999.1| PREDICTED: pentatricopeptide repeat-containi... 147 3e-33 ref|XP_012852998.1| PREDICTED: pentatricopeptide repeat-containi... 147 3e-33 gb|EYU24364.1| hypothetical protein MIMGU_mgv1a018765mg, partial... 147 3e-33 ref|XP_011040829.1| PREDICTED: pentatricopeptide repeat-containi... 142 7e-32 ref|XP_006384866.1| hypothetical protein POPTR_0004s21780g [Popu... 142 7e-32 ref|XP_011087234.1| PREDICTED: pentatricopeptide repeat-containi... 142 1e-31 ref|XP_012074714.1| PREDICTED: pentatricopeptide repeat-containi... 137 4e-30 ref|XP_010090714.1| hypothetical protein L484_013736 [Morus nota... 136 6e-30 ref|XP_009630538.1| PREDICTED: pentatricopeptide repeat-containi... 136 6e-30 ref|XP_009358895.1| PREDICTED: pentatricopeptide repeat-containi... 135 8e-30 ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containi... 135 1e-29 ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_004253182.1| PREDICTED: pentatricopeptide repeat-containi... 134 3e-29 ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containi... 133 4e-29 ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containi... 132 7e-29 gb|KDO68372.1| hypothetical protein CISIN_1g045672mg [Citrus sin... 132 7e-29 ref|XP_002514406.1| pentatricopeptide repeat-containing protein,... 132 7e-29 ref|XP_006486584.1| PREDICTED: pentatricopeptide repeat-containi... 132 7e-29 ref|XP_006422411.1| hypothetical protein CICLE_v10028001mg [Citr... 132 7e-29 ref|XP_012458973.1| PREDICTED: pentatricopeptide repeat-containi... 132 1e-28 >ref|XP_012852999.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X2 [Erythranthe guttatus] Length = 662 Score = 147 bits (371), Expect = 3e-33 Identities = 72/88 (81%), Positives = 78/88 (88%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVV+WTTMIAAYSNSE KALEMLI MLR GVRPNMYTYSSVLRAC+GL NL QLHC Sbjct: 157 RNVVTWTTMIAAYSNSEHKYKALEMLIMMLRDGVRPNMYTYSSVLRACEGLTNLKQLHCC 216 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQA 265 IIKVG E DVFVRSA+IDIYSKWGE+++ Sbjct: 217 IIKVGLELDVFVRSAVIDIYSKWGEVKS 244 >ref|XP_012852998.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Erythranthe guttatus] Length = 696 Score = 147 bits (371), Expect = 3e-33 Identities = 72/88 (81%), Positives = 78/88 (88%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVV+WTTMIAAYSNSE KALEMLI MLR GVRPNMYTYSSVLRAC+GL NL QLHC Sbjct: 191 RNVVTWTTMIAAYSNSEHKYKALEMLIMMLRDGVRPNMYTYSSVLRACEGLTNLKQLHCC 250 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQA 265 IIKVG E DVFVRSA+IDIYSKWGE+++ Sbjct: 251 IIKVGLELDVFVRSAVIDIYSKWGEVKS 278 >gb|EYU24364.1| hypothetical protein MIMGU_mgv1a018765mg, partial [Erythranthe guttata] Length = 698 Score = 147 bits (371), Expect = 3e-33 Identities = 72/88 (81%), Positives = 78/88 (88%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVV+WTTMIAAYSNSE KALEMLI MLR GVRPNMYTYSSVLRAC+GL NL QLHC Sbjct: 317 RNVVTWTTMIAAYSNSEHKYKALEMLIMMLRDGVRPNMYTYSSVLRACEGLTNLKQLHCC 376 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQA 265 IIKVG E DVFVRSA+IDIYSKWGE+++ Sbjct: 377 IIKVGLELDVFVRSAVIDIYSKWGEVKS 404 >ref|XP_011040829.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Populus euphratica] Length = 644 Score = 142 bits (359), Expect = 7e-32 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYS ++ + KALE L+ MLR+GVRPNM+TYSSVLRAC GLFNL QLHC Sbjct: 139 RNVVSWTTMISAYSAAKLNDKALEFLVLMLREGVRPNMFTYSSVLRACDGLFNLRQLHCC 198 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIK+G +SDVFVRSALID+YS+WGEL+ Sbjct: 199 IIKIGLDSDVFVRSALIDVYSRWGELE 225 >ref|XP_006384866.1| hypothetical protein POPTR_0004s21780g [Populus trichocarpa] gi|550341634|gb|ERP62663.1| hypothetical protein POPTR_0004s21780g [Populus trichocarpa] Length = 571 Score = 142 bits (359), Expect = 7e-32 Identities = 66/87 (75%), Positives = 78/87 (89%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYS ++ + KALE L+ MLR+GVRPNM+TYSSVLRAC GLFNL QLHC Sbjct: 66 RNVVSWTTMISAYSAAKLNDKALEFLVLMLREGVRPNMFTYSSVLRACDGLFNLRQLHCC 125 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIK+G +SDVFVRSALID+YS+WGEL+ Sbjct: 126 IIKIGLDSDVFVRSALIDVYSRWGELE 152 >ref|XP_011087234.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] gi|747080002|ref|XP_011087235.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] gi|747080004|ref|XP_011087237.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] Length = 661 Score = 142 bits (357), Expect = 1e-31 Identities = 69/88 (78%), Positives = 75/88 (85%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 +N VSWTTMIAAYSN+E + KALEMLI MLR GVRPNMYTYSSVLRAC+G L Q+HC Sbjct: 156 KNFVSWTTMIAAYSNAELNYKALEMLIMMLRDGVRPNMYTYSSVLRACEGFSTLKQIHCC 215 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQA 265 IIKVG E DVFVRSALIDIY KWGEL+A Sbjct: 216 IIKVGLELDVFVRSALIDIYCKWGELKA 243 >ref|XP_012074714.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Jatropha curcas] gi|643741607|gb|KDP47022.1| hypothetical protein JCGZ_10749 [Jatropha curcas] Length = 632 Score = 137 bits (344), Expect = 4e-30 Identities = 67/87 (77%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYSN++ + KALE LI MLR+GVRPNMYTYS+VLRAC+ L NL QLH + Sbjct: 127 RNVVSWTTMISAYSNAKLNDKALEFLISMLREGVRPNMYTYSTVLRACERLSNLRQLHGN 186 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIK G ESDVFVRSALIDIYSKWGE + Sbjct: 187 IIKSGLESDVFVRSALIDIYSKWGECE 213 >ref|XP_010090714.1| hypothetical protein L484_013736 [Morus notabilis] gi|587850247|gb|EXB40433.1| hypothetical protein L484_013736 [Morus notabilis] Length = 640 Score = 136 bits (342), Expect = 6e-30 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTT+IAAYSN++ +++ALE L+ MLR GV PNM+TYSSVLRAC GL+NL QLHCS Sbjct: 135 RNVVSWTTIIAAYSNAKLNERALEFLVLMLRDGVMPNMFTYSSVLRACDGLWNLRQLHCS 194 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 I K G ESDVFVRSALID+YSK GEL+ Sbjct: 195 IFKAGLESDVFVRSALIDVYSKLGELR 221 >ref|XP_009630538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] gi|697152613|ref|XP_009630539.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] gi|697152615|ref|XP_009630540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] gi|697152617|ref|XP_009630541.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] gi|697152619|ref|XP_009630542.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] Length = 659 Score = 136 bits (342), Expect = 6e-30 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMIAAYS+++ + KALE LI MLR GVRPNM+TYSSVLR+C L NL QLHCS Sbjct: 154 RNVVSWTTMIAAYSSAKINNKALEFLILMLRDGVRPNMFTYSSVLRSCDDLSNLGQLHCS 213 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 I+KVG ESDVFVRSALID+YSK G+L+ Sbjct: 214 ILKVGLESDVFVRSALIDVYSKMGQLE 240 >ref|XP_009358895.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Pyrus x bretschneideri] Length = 656 Score = 135 bits (341), Expect = 8e-30 Identities = 66/86 (76%), Positives = 73/86 (84%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYSN +F++KALE L+ MLR+GV PN YTYSSVLRAC GL NL QLHC Sbjct: 151 RNVVSWTTMISAYSNYKFNRKALEFLVLMLREGVSPNSYTYSSVLRACDGLLNLKQLHCC 210 Query: 182 IIKVGFESDVFVRSALIDIYSKWGEL 259 I K G ESDVFVRSALID+YSK GEL Sbjct: 211 IFKAGLESDVFVRSALIDVYSKLGEL 236 >ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis sativus] gi|700191440|gb|KGN46644.1| hypothetical protein Csa_6G117760 [Cucumis sativus] Length = 624 Score = 135 bits (340), Expect = 1e-29 Identities = 68/85 (80%), Positives = 73/85 (85%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYSNS + KAL+ LI MLR+GVRPNMYTYSSVLRAC GL NL QLH S Sbjct: 118 RNVVSWTTMISAYSNSNLNHKALDFLILMLREGVRPNMYTYSSVLRACDGLLNLRQLHGS 177 Query: 182 IIKVGFESDVFVRSALIDIYSKWGE 256 I+KVG ESDVFVRSALID YSK GE Sbjct: 178 ILKVGLESDVFVRSALIDTYSKLGE 202 >ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519769|ref|XP_009804753.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519771|ref|XP_009804754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519773|ref|XP_009804755.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519775|ref|XP_009804757.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519777|ref|XP_009804758.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] gi|698519779|ref|XP_009804759.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] Length = 659 Score = 134 bits (338), Expect = 2e-29 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMIAAYS+++ + KALE LI MLR GVRPNM+TYSSVLRAC L NL QLHCS Sbjct: 154 RNVVSWTTMIAAYSSAKINNKALEFLILMLRDGVRPNMFTYSSVLRACDDLSNLRQLHCS 213 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 I+KVG E DVFVRSALID+YSK G+L+ Sbjct: 214 ILKVGLEFDVFVRSALIDVYSKMGQLE 240 >ref|XP_004253182.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum lycopersicum] Length = 654 Score = 134 bits (336), Expect = 3e-29 Identities = 64/87 (73%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMIAAYS+++ + KALE LI M+R GV+PNM+TYSSVLRAC L NL QLHCS Sbjct: 149 RNVVSWTTMIAAYSSAKINNKALEFLIFMMRDGVKPNMFTYSSVLRACDDLSNLRQLHCS 208 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 ++KVG ESDVFVRSALID+YSK G+L+ Sbjct: 209 LLKVGLESDVFVRSALIDVYSKMGQLE 235 >ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 654 Score = 133 bits (335), Expect = 4e-29 Identities = 64/87 (73%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMIAAYS+++ + KALE LI M+R GVRPNM+T+SSVLRAC L NL QLHCS Sbjct: 149 RNVVSWTTMIAAYSSAKINNKALEFLILMMRDGVRPNMFTFSSVLRACDDLSNLRQLHCS 208 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 ++KVG ESDVFVRSALID+YSK G+L+ Sbjct: 209 LLKVGLESDVFVRSALIDVYSKMGQLK 235 >ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis melo] Length = 624 Score = 132 bits (333), Expect = 7e-29 Identities = 67/84 (79%), Positives = 72/84 (85%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AYSNS + KALE LI MLR+GVRPNM+TYSSVLRAC GL NL QLH S Sbjct: 118 RNVVSWTTMISAYSNSNLNHKALEFLILMLREGVRPNMFTYSSVLRACDGLLNLRQLHGS 177 Query: 182 IIKVGFESDVFVRSALIDIYSKWG 253 I+KVG ESDVFVRSALID YSK G Sbjct: 178 IMKVGLESDVFVRSALIDTYSKLG 201 >gb|KDO68372.1| hypothetical protein CISIN_1g045672mg [Citrus sinensis] Length = 643 Score = 132 bits (333), Expect = 7e-29 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AY +++ + KALE+LI MLR+GVRPNM+TYS+VLRAC L L QLHC Sbjct: 138 RNVVSWTTMISAYCDAKMNDKALELLIFMLREGVRPNMFTYSAVLRACDSLIILRQLHCG 197 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIKVGFESDVFVRSALIDIY+K GEL+ Sbjct: 198 IIKVGFESDVFVRSALIDIYAKLGELR 224 >ref|XP_002514406.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546503|gb|EEF48002.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 436 Score = 132 bits (333), Expect = 7e-29 Identities = 62/85 (72%), Positives = 76/85 (89%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+A+SN++ + KALE LI MLR+GV+PN+YTYSS+LRAC G++NL QLH + Sbjct: 121 RNVVSWTTMISAFSNAKLNDKALEFLICMLREGVKPNVYTYSSILRACDGVYNLRQLHGN 180 Query: 182 IIKVGFESDVFVRSALIDIYSKWGE 256 IIK G +SDV+VRSALIDIYSKWGE Sbjct: 181 IIKSGLDSDVYVRSALIDIYSKWGE 205 >ref|XP_006486584.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Citrus sinensis] Length = 645 Score = 132 bits (333), Expect = 7e-29 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AY +++ + KALE+LI MLR+GVRPNM+TYS+VLRAC L L QLHC Sbjct: 140 RNVVSWTTMISAYCDAKMNDKALELLIFMLREGVRPNMFTYSAVLRACDSLIILRQLHCG 199 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIKVGFESDVFVRSALIDIY+K GEL+ Sbjct: 200 IIKVGFESDVFVRSALIDIYAKLGELR 226 >ref|XP_006422411.1| hypothetical protein CICLE_v10028001mg [Citrus clementina] gi|557524345|gb|ESR35651.1| hypothetical protein CICLE_v10028001mg [Citrus clementina] Length = 643 Score = 132 bits (333), Expect = 7e-29 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AY +++ + KALE+LI MLR+GVRPNM+TYS+VLRAC L L QLHC Sbjct: 138 RNVVSWTTMISAYCDAKMNDKALELLIFMLREGVRPNMFTYSAVLRACDSLIILRQLHCG 197 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 IIKVGFESDVFVRSALIDIY+K GEL+ Sbjct: 198 IIKVGFESDVFVRSALIDIYAKLGELR 224 >ref|XP_012458973.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Gossypium raimondii] gi|763810567|gb|KJB77469.1| hypothetical protein B456_012G138600 [Gossypium raimondii] Length = 643 Score = 132 bits (331), Expect = 1e-28 Identities = 62/87 (71%), Positives = 75/87 (86%) Frame = +2 Query: 2 RNVVSWTTMIAAYSNSEFSQKALEMLIQMLRQGVRPNMYTYSSVLRACKGLFNLAQLHCS 181 RNVVSWTTMI+AY+N++ S KALE + MLR+GV PNM+T+SSVLRAC GLFN+ QLHC Sbjct: 138 RNVVSWTTMISAYANAKLSDKALEFFVLMLREGVLPNMFTFSSVLRACNGLFNVRQLHCG 197 Query: 182 IIKVGFESDVFVRSALIDIYSKWGELQ 262 +IK+G ESDVFVRSALID+YSK EL+ Sbjct: 198 MIKLGLESDVFVRSALIDVYSKLDELK 224