BLASTX nr result
ID: Forsythia22_contig00055965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055965 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] 61 3e-07 ref|YP_009133095.1| Ycf2 (chloroplast) [Quercus aquifolioides] g... 60 4e-07 ref|YP_009130364.1| Ycf2 (chloroplast) [Quercus aliena] gi|81093... 60 4e-07 ref|YP_009123786.1| hypothetical chloroplast RF21 [Lithocarpus b... 60 4e-07 ref|YP_009114278.1| Ycf2 protein (chloroplast) [Sedum takesimens... 60 4e-07 ref|YP_009092347.1| putative chloroplast RF21 (chloroplast) [Mac... 60 4e-07 ref|YP_009048354.1| Ycf2 (chloroplast) [Magnolia yunnanensis] gi... 60 4e-07 gb|ADD30901.1| putative RF2 protein (chloroplast) [Trochodendron... 60 4e-07 ref|YP_007375087.1| hypothetical chloroplast RF21 [Quercus rubra... 60 4e-07 gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sang... 60 4e-07 gb|ADD30890.1| putative RF2 protein (chloroplast) [Berberidopsis... 60 4e-07 gb|ADD30886.1| putative RF2 protein (chloroplast) [Nelumbo nucif... 60 4e-07 gb|ADD30885.1| putative RF2 protein (chloroplast) [Meliosma aff.... 60 4e-07 ref|YP_009024834.1| hypothetical chloroplast RF21 (chloroplast) ... 60 4e-07 ref|YP_009020263.1| hypothetical chloroplast RF21 (chloroplast) ... 60 4e-07 ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) ... 60 4e-07 ref|YP_008963522.1| hypothetical chloroplast RF21 (chloroplast) ... 60 4e-07 ref|YP_008081501.1| Ycf2 (chloroplast) [Trochodendron aralioides... 60 4e-07 gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 60 4e-07 ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [... 60 4e-07 >gb|ABQ14933.1| Ycf2 [Saxifraga stolonifera] Length = 2274 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 78 QYKQESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 Q + ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 444 QTEIESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 479 >ref|YP_009133095.1| Ycf2 (chloroplast) [Quercus aquifolioides] gi|813428158|ref|YP_009133111.1| Ycf2 (chloroplast) [Quercus aquifolioides] gi|806935470|gb|AKC05509.1| Ycf2 (chloroplast) [Quercus aquifolioides] gi|806935486|gb|AKC05525.1| Ycf2 (chloroplast) [Quercus aquifolioides] Length = 2277 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 447 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 478 >ref|YP_009130364.1| Ycf2 (chloroplast) [Quercus aliena] gi|810933003|ref|YP_009130380.1| Ycf2 (chloroplast) [Quercus aliena] gi|769471269|gb|AJW60190.1| Ycf2 (chloroplast) [Quercus aliena] gi|769471285|gb|AJW60206.1| Ycf2 (chloroplast) [Quercus aliena] Length = 2273 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 443 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 474 >ref|YP_009123786.1| hypothetical chloroplast RF21 [Lithocarpus balansae] gi|788229618|ref|YP_009123805.1| hypothetical chloroplast RF21 [Lithocarpus balansae] gi|757174659|gb|AJN91062.1| hypothetical chloroplast RF21 [Lithocarpus balansae] gi|757174660|gb|AJN91063.1| hypothetical chloroplast RF21 [Lithocarpus balansae] Length = 2279 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 447 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 478 >ref|YP_009114278.1| Ycf2 protein (chloroplast) [Sedum takesimense] gi|746001741|ref|YP_009114295.1| Ycf2 protein (chloroplast) [Sedum takesimense] gi|586598493|gb|AHJ61275.1| Ycf2 protein (chloroplast) [Sedum takesimense] gi|586598510|gb|AHJ61292.1| Ycf2 protein (chloroplast) [Sedum takesimense] Length = 2282 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >ref|YP_009092347.1| putative chloroplast RF21 (chloroplast) [Macadamia integrifolia] gi|712911660|ref|YP_009092367.1| putative chloroplast RF21 (chloroplast) [Macadamia integrifolia] gi|563321873|gb|AHB38202.1| putative chloroplast RF21 (chloroplast) [Macadamia integrifolia] gi|563321895|gb|AHB38224.1| putative chloroplast RF21 (chloroplast) [Macadamia integrifolia] Length = 2274 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >ref|YP_009048354.1| Ycf2 (chloroplast) [Magnolia yunnanensis] gi|669100340|ref|YP_009048331.1| Ycf2 (chloroplast) [Magnolia yunnanensis] gi|573015502|gb|AHF72080.1| Ycf2 (chloroplast) [Magnolia yunnanensis] gi|573015503|gb|AHF72081.1| Ycf2 (chloroplast) [Magnolia yunnanensis] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 451 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 482 >gb|ADD30901.1| putative RF2 protein (chloroplast) [Trochodendron aralioides] Length = 2293 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >ref|YP_007375087.1| hypothetical chloroplast RF21 [Quercus rubra] gi|443267372|ref|YP_007375108.1| hypothetical chloroplast RF21 [Quercus rubra] gi|290489030|gb|ADD30899.1| putative RF2 protein (chloroplast) [Quercus nigra] gi|340807124|gb|AEK71723.1| hypothetical chloroplast RF2 [Quercus nigra] gi|441421966|gb|AGC31290.1| hypothetical chloroplast RF21 [Quercus rubra] gi|441421987|gb|AGC31311.1| hypothetical chloroplast RF21 [Quercus rubra] Length = 2277 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 447 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 478 >gb|ADD30895.1| putative RF2 protein (chloroplast) [Heuchera sanguinea] gi|340807140|gb|AEK71737.1| hypothetical chloroplast RF2 [Heuchera sanguinea] Length = 2290 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >gb|ADD30890.1| putative RF2 protein (chloroplast) [Berberidopsis corallina] gi|340807100|gb|AEK71702.1| hypothetical chloroplast RF2 [Berberidopsis corallina] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >gb|ADD30886.1| putative RF2 protein (chloroplast) [Nelumbo nucifera] Length = 2304 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 448 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 479 >gb|ADD30885.1| putative RF2 protein (chloroplast) [Meliosma aff. cuneifolia Moore 333] gi|340807022|gb|AEK71639.1| hypothetical chloroplast RF2 [Meliosma aff. cuneifolia M. J. Moore 333] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 444 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 475 >ref|YP_009024834.1| hypothetical chloroplast RF21 (chloroplast) [Trigonobalanus doichangensis] gi|609253172|ref|YP_009024851.1| hypothetical chloroplast RF21 (chloroplast) [Trigonobalanus doichangensis] gi|597710405|gb|AHN16166.1| hypothetical chloroplast RF21 (chloroplast) [Trigonobalanus doichangensis] gi|597710422|gb|AHN16183.1| hypothetical chloroplast RF21 (chloroplast) [Trigonobalanus doichangensis] Length = 2280 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 449 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 480 >ref|YP_009020263.1| hypothetical chloroplast RF21 (chloroplast) [Castanopsis echinocarpa] gi|595789999|ref|YP_009020281.1| hypothetical chloroplast RF21 (chloroplast) [Castanopsis echinocarpa] gi|589387994|gb|AHL16950.1| hypothetical chloroplast RF21 (chloroplast) [Castanopsis echinocarpa] gi|589388013|gb|AHL16969.1| hypothetical chloroplast RF21 (chloroplast) [Castanopsis echinocarpa] Length = 2275 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 445 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 476 >ref|YP_008963735.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|568244972|ref|YP_008963754.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650414|gb|AGL13474.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] gi|491650433|gb|AGL13493.1| hypothetical chloroplast RF21 (chloroplast) [Liquidambar formosana] Length = 2297 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >ref|YP_008963522.1| hypothetical chloroplast RF21 (chloroplast) [Penthorum chinense] gi|568244793|ref|YP_008963539.1| hypothetical chloroplast RF21 (chloroplast) [Penthorum chinense] gi|403226823|gb|AFR25702.1| hypothetical chloroplast RF21 (chloroplast) [Penthorum chinense] gi|403226840|gb|AFR25719.1| hypothetical chloroplast RF21 (chloroplast) [Penthorum chinense] Length = 2312 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 446 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 477 >ref|YP_008081501.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|511348592|ref|YP_008081518.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|479279340|gb|AGJ72193.1| Ycf2 (chloroplast) [Trochodendron aralioides] gi|479279357|gb|AGJ72210.1| Ycf2 (chloroplast) [Trochodendron aralioides] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 451 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 482 >gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 451 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 482 >ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|452848915|ref|YP_007474596.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] gi|372862885|gb|AEX98961.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|372862902|gb|AEX98978.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 90 ESDRFPKCLSGYSSMSRLVTEHEKQMSNQLLP 185 ESDRFPKCLSGYSSMSRL TE EKQM+N LLP Sbjct: 451 ESDRFPKCLSGYSSMSRLFTEREKQMNNHLLP 482